Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1324582..1325230 | Replicon | chromosome |
| Accession | NZ_CP128519 | ||
| Organism | Mannheimia haemolytica strain 192036 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | QTV54_RS06915 | Protein ID | WP_006251221.1 |
| Coordinates | 1324582..1324758 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | QTV54_RS06920 | Protein ID | WP_006251222.1 |
| Coordinates | 1324814..1325230 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV54_RS06895 | 1319900..1322395 | - | 2496 | WP_006251216.1 | phage tail length tape measure family protein | - |
| QTV54_RS06900 | 1322940..1323398 | - | 459 | WP_006251218.1 | hypothetical protein | - |
| QTV54_RS06905 | 1323567..1323800 | + | 234 | WP_020824316.1 | hypothetical protein | - |
| QTV54_RS06910 | 1323815..1324480 | - | 666 | WP_015587050.1 | DUF6246 family protein | - |
| QTV54_RS06915 | 1324582..1324758 | + | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QTV54_RS06920 | 1324814..1325230 | + | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QTV54_RS06925 | 1325270..1325752 | - | 483 | WP_006251223.1 | phage tail tube protein | - |
| QTV54_RS06930 | 1325756..1326136 | - | 381 | WP_006251224.1 | hypothetical protein | - |
| QTV54_RS06935 | 1326133..1326501 | - | 369 | WP_006251225.1 | hypothetical protein | - |
| QTV54_RS06940 | 1326503..1326847 | - | 345 | WP_006251226.1 | hypothetical protein | - |
| QTV54_RS06945 | 1326847..1327224 | - | 378 | WP_006251227.1 | hypothetical protein | - |
| QTV54_RS06950 | 1327227..1327514 | - | 288 | WP_186806282.1 | hypothetical protein | - |
| QTV54_RS06955 | 1327526..1328515 | - | 990 | WP_006251229.1 | encapsulin | - |
| QTV54_RS06960 | 1328530..1328964 | - | 435 | WP_006251230.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1300793..1388005 | 87212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T284730 WP_006251221.1 NZ_CP128519:1324582-1324758 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT284730 WP_006251222.1 NZ_CP128519:1324814-1325230 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |