Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 954313..954953 | Replicon | chromosome |
| Accession | NZ_CP128519 | ||
| Organism | Mannheimia haemolytica strain 192036 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A378NFX7 |
| Locus tag | QTV54_RS04985 | Protein ID | WP_006250075.1 |
| Coordinates | 954771..954953 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A378NFW9 |
| Locus tag | QTV54_RS04980 | Protein ID | WP_006250074.1 |
| Coordinates | 954313..954732 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV54_RS04960 | 949826..950632 | + | 807 | WP_006248821.1 | tryptophan synthase subunit alpha | - |
| QTV54_RS04965 | 950682..952088 | + | 1407 | WP_006253513.1 | YdgA family protein | - |
| QTV54_RS04970 | 952155..953195 | - | 1041 | WP_015587023.1 | IS481 family transposase | - |
| QTV54_RS04975 | 953333..953977 | - | 645 | WP_006253274.1 | tyrosine-type recombinase/integrase | - |
| QTV54_RS04980 | 954313..954732 | - | 420 | WP_006250074.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QTV54_RS04985 | 954771..954953 | - | 183 | WP_006250075.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QTV54_RS04990 | 955085..955582 | - | 498 | WP_006250077.1 | hypothetical protein | - |
| QTV54_RS04995 | 955575..955955 | - | 381 | WP_006248823.1 | hypothetical protein | - |
| QTV54_RS05000 | 956030..956713 | - | 684 | WP_006248824.1 | S24 family peptidase | - |
| QTV54_RS05005 | 956844..957044 | + | 201 | WP_006248825.1 | YdaS family helix-turn-helix protein | - |
| QTV54_RS05010 | 957065..958132 | + | 1068 | WP_006253284.1 | hypothetical protein | - |
| QTV54_RS05015 | 958142..958300 | + | 159 | WP_006247809.1 | hypothetical protein | - |
| QTV54_RS05020 | 958360..959400 | - | 1041 | WP_015587043.1 | IS481 family transposase | - |
| QTV54_RS05025 | 959517..959816 | - | 300 | WP_006247810.1 | XRE family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 952155..953195 | 1040 | |
| - | flank | IS/Tn | - | - | 958360..959400 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6933.03 Da Isoelectric Point: 10.3446
>T284729 WP_006250075.1 NZ_CP128519:c954953-954771 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15938.30 Da Isoelectric Point: 4.6963
>AT284729 WP_006250074.1 NZ_CP128519:c954732-954313 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378NFX7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378NFW9 |