Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 272639..273289 | Replicon | chromosome |
Accession | NZ_CP128519 | ||
Organism | Mannheimia haemolytica strain 192036 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A547EDJ6 |
Locus tag | QTV54_RS01355 | Protein ID | WP_006249411.1 |
Coordinates | 272900..273289 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A547EDM1 |
Locus tag | QTV54_RS01350 | Protein ID | WP_006249412.1 |
Coordinates | 272639..272899 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV54_RS01335 | 268327..271860 | + | 3534 | WP_006253629.1 | transcription-repair coupling factor | - |
QTV54_RS01340 | 272023..272310 | + | 288 | WP_006251764.1 | BrnT family toxin | - |
QTV54_RS01345 | 272311..272523 | + | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
QTV54_RS01350 | 272639..272899 | + | 261 | WP_006249412.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QTV54_RS01355 | 272900..273289 | + | 390 | WP_006249411.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QTV54_RS01360 | 273309..274547 | + | 1239 | WP_006253630.1 | peptidase T | - |
QTV54_RS01390 | 275290..276075 | + | 786 | WP_006251768.1 | hypothetical protein | - |
QTV54_RS01395 | 276149..277009 | + | 861 | WP_006250124.1 | metal ABC transporter permease | - |
QTV54_RS01400 | 277002..277811 | + | 810 | WP_006250123.1 | metal ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14633.91 Da Isoelectric Point: 7.1041
>T284727 WP_006249411.1 NZ_CP128519:272900-273289 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547EDJ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547EDM1 |