Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1571879..1572527 | Replicon | chromosome |
| Accession | NZ_CP128518 | ||
| Organism | Mannheimia haemolytica strain 192037 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | QTV60_RS08095 | Protein ID | WP_006251221.1 |
| Coordinates | 1571879..1572055 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | QTV60_RS08100 | Protein ID | WP_006251222.1 |
| Coordinates | 1572111..1572527 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV60_RS08075 | 1567197..1569692 | - | 2496 | WP_006251216.1 | phage tail length tape measure family protein | - |
| QTV60_RS08080 | 1570237..1570695 | - | 459 | WP_006251218.1 | hypothetical protein | - |
| QTV60_RS08085 | 1570864..1571097 | + | 234 | WP_020824316.1 | hypothetical protein | - |
| QTV60_RS08090 | 1571112..1571777 | - | 666 | WP_015587050.1 | DUF6246 family protein | - |
| QTV60_RS08095 | 1571879..1572055 | + | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QTV60_RS08100 | 1572111..1572527 | + | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QTV60_RS08105 | 1572567..1573049 | - | 483 | WP_006251223.1 | phage tail tube protein | - |
| QTV60_RS08110 | 1573053..1573433 | - | 381 | WP_006251224.1 | hypothetical protein | - |
| QTV60_RS08115 | 1573430..1573798 | - | 369 | WP_006251225.1 | hypothetical protein | - |
| QTV60_RS08120 | 1573800..1574144 | - | 345 | WP_006251226.1 | hypothetical protein | - |
| QTV60_RS08125 | 1574144..1574521 | - | 378 | WP_006251227.1 | hypothetical protein | - |
| QTV60_RS08130 | 1574524..1574784 | - | 261 | WP_020824317.1 | hypothetical protein | - |
| QTV60_RS08135 | 1574796..1575785 | - | 990 | WP_006251229.1 | encapsulin | - |
| QTV60_RS08140 | 1575800..1576234 | - | 435 | WP_006251230.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1554789..1678418 | 123629 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T284722 WP_006251221.1 NZ_CP128518:1571879-1572055 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT284722 WP_006251222.1 NZ_CP128518:1572111-1572527 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |