Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 828566..829105 Replicon chromosome
Accession NZ_CP128518
Organism Mannheimia haemolytica strain 192037

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV60_RS04185 Protein ID WP_006247804.1
Coordinates 828566..828835 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV60_RS04190 Protein ID WP_006247803.1
Coordinates 828839..829105 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV60_RS04140 823700..823999 + 300 WP_006247810.1 XRE family transcriptional regulator -
QTV60_RS04145 824008..824166 - 159 WP_006247809.1 hypothetical protein -
QTV60_RS04150 824176..824862 - 687 WP_006247808.1 hypothetical protein -
QTV60_RS04155 824973..825584 - 612 WP_006253310.1 hypothetical protein -
QTV60_RS04160 825633..826259 - 627 WP_006247807.1 tail assembly protein -
QTV60_RS04165 826481..827200 - 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV60_RS04170 827190..827480 - 291 Protein_783 NlpC/P60 family protein -
QTV60_RS04175 827458..828168 - 711 WP_006253312.1 tape measure protein -
QTV60_RS04180 828228..828491 - 264 WP_006247805.1 hypothetical protein -
QTV60_RS04185 828566..828835 - 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV60_RS04190 828839..829105 - 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV60_RS04195 829173..829403 - 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV60_RS04200 829448..829849 - 402 WP_006247801.1 hypothetical protein -
QTV60_RS04205 829932..830573 - 642 WP_006247800.1 hypothetical protein -
QTV60_RS04210 830605..831000 - 396 WP_006247799.1 phage tail terminator protein -
QTV60_RS04215 831025..831252 - 228 Protein_792 phage terminase large subunit family protein -
QTV60_RS04220 831402..831776 + 375 WP_006247798.1 hypothetical protein -
QTV60_RS04225 831784..831951 + 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV60_RS04230 832032..832355 + 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV60_RS04235 832259..832969 + 711 Protein_796 site-specific integrase -
QTV60_RS04240 833070..833705 + 636 Protein_797 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 821225..856495 35270
- flank IS/Tn - - 833070..833762 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284721 WP_006247804.1 NZ_CP128518:c828835-828566 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284721 WP_006247803.1 NZ_CP128518:c829105-828839 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References