Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 1737153..1737692 Replicon chromosome
Accession NZ_CP128516
Organism Mannheimia haemolytica strain 192916

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV68_RS09265 Protein ID WP_006247804.1
Coordinates 1737423..1737692 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV68_RS09260 Protein ID WP_006247803.1
Coordinates 1737153..1737419 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV68_RS09210 1732553..1733188 - 636 Protein_1789 helix-turn-helix domain-containing protein -
QTV68_RS09215 1733289..1733999 - 711 Protein_1790 site-specific integrase -
QTV68_RS09220 1733903..1734226 - 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV68_RS09225 1734307..1734474 - 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV68_RS09230 1734482..1734856 - 375 WP_006247798.1 hypothetical protein -
QTV68_RS09235 1735006..1735233 + 228 Protein_1794 phage terminase large subunit family protein -
QTV68_RS09240 1735258..1735653 + 396 WP_006247799.1 phage tail terminator protein -
QTV68_RS09245 1735685..1736326 + 642 WP_006247800.1 hypothetical protein -
QTV68_RS09250 1736409..1736810 + 402 WP_006247801.1 hypothetical protein -
QTV68_RS09255 1736855..1737085 + 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV68_RS09260 1737153..1737419 + 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV68_RS09265 1737423..1737692 + 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV68_RS09270 1737767..1738030 + 264 WP_006247805.1 hypothetical protein -
QTV68_RS09275 1738090..1738800 + 711 WP_006253312.1 tape measure protein -
QTV68_RS09280 1738778..1739068 + 291 Protein_1803 NlpC/P60 family protein -
QTV68_RS09285 1739058..1739777 + 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV68_RS09290 1739999..1740625 + 627 WP_006247807.1 tail assembly protein -
QTV68_RS09295 1740674..1741285 + 612 WP_006253310.1 hypothetical protein -
QTV68_RS09300 1741396..1742082 + 687 WP_006247808.1 hypothetical protein -
QTV68_RS09305 1742092..1742250 + 159 WP_006247809.1 hypothetical protein -
QTV68_RS09310 1742259..1742558 - 300 WP_006247810.1 XRE family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1723246..1748746 25500
- flank IS/Tn - - 1732496..1733188 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284713 WP_006247804.1 NZ_CP128516:1737423-1737692 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284713 WP_006247803.1 NZ_CP128516:1737153-1737419 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References