Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1251162..1251810 | Replicon | chromosome |
| Accession | NZ_CP128515 | ||
| Organism | Mannheimia haemolytica strain 192964 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | QTV66_RS06595 | Protein ID | WP_006251221.1 |
| Coordinates | 1251634..1251810 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | QTV66_RS06590 | Protein ID | WP_006251222.1 |
| Coordinates | 1251162..1251578 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV66_RS06550 | 1247383..1247817 | + | 435 | WP_006251230.1 | hypothetical protein | - |
| QTV66_RS06555 | 1247832..1248821 | + | 990 | WP_006251229.1 | encapsulin | - |
| QTV66_RS06560 | 1248833..1249165 | + | 333 | WP_147036295.1 | hypothetical protein | - |
| QTV66_RS06565 | 1249168..1249545 | + | 378 | WP_006251227.1 | hypothetical protein | - |
| QTV66_RS06570 | 1249545..1249889 | + | 345 | WP_006251226.1 | hypothetical protein | - |
| QTV66_RS06575 | 1249891..1250259 | + | 369 | WP_006251225.1 | hypothetical protein | - |
| QTV66_RS06580 | 1250256..1250636 | + | 381 | WP_006251224.1 | hypothetical protein | - |
| QTV66_RS06585 | 1250640..1251122 | + | 483 | WP_006251223.1 | phage tail tube protein | - |
| QTV66_RS06590 | 1251162..1251578 | - | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QTV66_RS06595 | 1251634..1251810 | - | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QTV66_RS06600 | 1251912..1252577 | + | 666 | WP_015587050.1 | DUF6246 family protein | - |
| QTV66_RS06605 | 1252592..1252825 | - | 234 | WP_020824316.1 | hypothetical protein | - |
| QTV66_RS06610 | 1252994..1253452 | + | 459 | WP_006251218.1 | hypothetical protein | - |
| QTV66_RS06615 | 1253997..1256492 | + | 2496 | WP_006251216.1 | phage tail length tape measure family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1218681..1268903 | 50222 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T284704 WP_006251221.1 NZ_CP128515:c1251810-1251634 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT284704 WP_006251222.1 NZ_CP128515:c1251578-1251162 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |