Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 828597..829136 Replicon chromosome
Accession NZ_CP128515
Organism Mannheimia haemolytica strain 192964

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV66_RS04185 Protein ID WP_006247804.1
Coordinates 828597..828866 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV66_RS04190 Protein ID WP_006247803.1
Coordinates 828870..829136 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV66_RS04140 823731..824030 + 300 WP_006247810.1 XRE family transcriptional regulator -
QTV66_RS04145 824039..824197 - 159 WP_006247809.1 hypothetical protein -
QTV66_RS04150 824207..824893 - 687 WP_006247808.1 hypothetical protein -
QTV66_RS04155 825004..825615 - 612 WP_006253310.1 hypothetical protein -
QTV66_RS04160 825664..826290 - 627 WP_006247807.1 tail assembly protein -
QTV66_RS04165 826512..827231 - 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV66_RS04170 827221..827511 - 291 Protein_783 NlpC/P60 family protein -
QTV66_RS04175 827489..828199 - 711 WP_006253312.1 tape measure protein -
QTV66_RS04180 828259..828522 - 264 WP_006247805.1 hypothetical protein -
QTV66_RS04185 828597..828866 - 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV66_RS04190 828870..829136 - 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV66_RS04195 829204..829434 - 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV66_RS04200 829479..829880 - 402 WP_006247801.1 hypothetical protein -
QTV66_RS04205 829963..830604 - 642 WP_006247800.1 hypothetical protein -
QTV66_RS04210 830636..831031 - 396 WP_006247799.1 phage tail terminator protein -
QTV66_RS04215 831056..831283 - 228 Protein_792 phage terminase large subunit family protein -
QTV66_RS04220 831433..831807 + 375 WP_006247798.1 hypothetical protein -
QTV66_RS04225 831815..831982 + 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV66_RS04230 832063..832386 + 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV66_RS04235 832290..833000 + 711 Protein_796 site-specific integrase -
QTV66_RS04240 833101..833736 + 636 Protein_797 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 821256..856526 35270
- flank IS/Tn - - 833101..833793 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284703 WP_006247804.1 NZ_CP128515:c828866-828597 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284703 WP_006247803.1 NZ_CP128515:c829136-828870 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References