Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 2124645..2125295 | Replicon | chromosome |
Accession | NZ_CP128511 | ||
Organism | Mannheimia haemolytica strain 202699 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A547EDJ6 |
Locus tag | QTV69_RS10960 | Protein ID | WP_006249411.1 |
Coordinates | 2124645..2125034 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A547EDM1 |
Locus tag | QTV69_RS10965 | Protein ID | WP_006249412.1 |
Coordinates | 2125035..2125295 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV69_RS10915 | 2120123..2120932 | - | 810 | WP_006250123.1 | metal ABC transporter permease | - |
QTV69_RS10920 | 2120925..2121785 | - | 861 | WP_006250124.1 | metal ABC transporter permease | - |
QTV69_RS10925 | 2121859..2122644 | - | 786 | WP_006251768.1 | hypothetical protein | - |
QTV69_RS10955 | 2123387..2124625 | - | 1239 | WP_006253630.1 | peptidase T | - |
QTV69_RS10960 | 2124645..2125034 | - | 390 | WP_006249411.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QTV69_RS10965 | 2125035..2125295 | - | 261 | WP_006249412.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QTV69_RS10970 | 2125411..2125623 | - | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
QTV69_RS10975 | 2125624..2125911 | - | 288 | WP_006251764.1 | BrnT family toxin | - |
QTV69_RS10980 | 2126074..2129607 | - | 3534 | WP_289333026.1 | transcription-repair coupling factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14633.91 Da Isoelectric Point: 7.1041
>T284692 WP_006249411.1 NZ_CP128511:c2125034-2124645 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547EDJ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547EDM1 |