Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 1833875..1834397 | Replicon | chromosome |
Accession | NZ_CP128511 | ||
Organism | Mannheimia haemolytica strain 202699 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A249A107 |
Locus tag | QTV69_RS09470 | Protein ID | WP_006249269.1 |
Coordinates | 1834101..1834397 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A249A190 |
Locus tag | QTV69_RS09465 | Protein ID | WP_006249270.1 |
Coordinates | 1833875..1834117 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV69_RS09440 | 1829713..1830802 | - | 1090 | Protein_1821 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
QTV69_RS09445 | 1830976..1831617 | - | 642 | WP_006249274.1 | orotate phosphoribosyltransferase | - |
QTV69_RS09450 | 1831740..1832582 | - | 843 | WP_006249273.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
QTV69_RS09455 | 1832642..1833217 | + | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
QTV69_RS09460 | 1833195..1833863 | - | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
QTV69_RS09465 | 1833875..1834117 | - | 243 | WP_006249270.1 | CopG family antitoxin | Antitoxin |
QTV69_RS09470 | 1834101..1834397 | - | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
QTV69_RS09475 | 1834524..1837436 | - | 2913 | WP_006249267.1 | RNA polymerase-associated protein RapA | - |
QTV69_RS09480 | 1837597..1837896 | - | 300 | WP_006249265.1 | hypothetical protein | - |
QTV69_RS09485 | 1838017..1839342 | - | 1326 | WP_006249264.1 | anti-phage deoxyguanosine triphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T284691 WP_006249269.1 NZ_CP128511:c1834397-1834101 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249A107 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249A190 |