Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2430457..2430973 | Replicon | chromosome |
| Accession | NZ_CP128508 | ||
| Organism | Pseudomonas asiatica strain F19-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F8G1E7 |
| Locus tag | QUC26_RS11310 | Protein ID | WP_003259987.1 |
| Coordinates | 2430692..2430973 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QUC26_RS11305 | Protein ID | WP_096010237.1 |
| Coordinates | 2430457..2430702 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUC26_RS11285 (QUC26_11285) | 2425884..2426426 | - | 543 | WP_013972039.1 | WYL domain-containing protein | - |
| QUC26_RS11290 (QUC26_11290) | 2426534..2427520 | - | 987 | WP_013972040.1 | zinc-binding dehydrogenase | - |
| QUC26_RS11295 (QUC26_11295) | 2427883..2429076 | + | 1194 | WP_025338595.1 | MFS transporter | - |
| QUC26_RS11300 (QUC26_11300) | 2429107..2430213 | + | 1107 | WP_096010236.1 | alkene reductase | - |
| QUC26_RS11305 (QUC26_11305) | 2430457..2430702 | + | 246 | WP_096010237.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QUC26_RS11310 (QUC26_11310) | 2430692..2430973 | + | 282 | WP_003259987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QUC26_RS11315 (QUC26_11315) | 2431012..2431407 | - | 396 | WP_023662326.1 | hypothetical protein | - |
| QUC26_RS11320 (QUC26_11320) | 2431496..2432404 | - | 909 | WP_096010238.1 | LysR family transcriptional regulator | - |
| QUC26_RS11325 (QUC26_11325) | 2432694..2433998 | + | 1305 | WP_013972046.1 | MFS transporter | - |
| QUC26_RS11330 (QUC26_11330) | 2434029..2435270 | + | 1242 | WP_013972047.1 | Zn-dependent hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10909.78 Da Isoelectric Point: 10.7594
>T284683 WP_003259987.1 NZ_CP128508:2430692-2430973 [Pseudomonas asiatica]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|