Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 2400889..2401442 | Replicon | chromosome |
Accession | NZ_CP128508 | ||
Organism | Pseudomonas asiatica strain F19-1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QUC26_RS11145 | Protein ID | WP_003155924.1 |
Coordinates | 2401149..2401442 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A431XAN4 |
Locus tag | QUC26_RS11140 | Protein ID | WP_003155922.1 |
Coordinates | 2400889..2401161 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC26_RS11135 (QUC26_11135) | 2400520..2400765 | + | 246 | Protein_2160 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QUC26_RS11140 (QUC26_11140) | 2400889..2401161 | + | 273 | WP_003155922.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QUC26_RS11145 (QUC26_11145) | 2401149..2401442 | + | 294 | WP_003155924.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QUC26_RS11150 (QUC26_11150) | 2401436..2402479 | - | 1044 | Protein_2163 | site-specific integrase | - |
QUC26_RS11155 (QUC26_11155) | 2402442..2402951 | + | 510 | Protein_2164 | IS5 family transposase | - |
QUC26_RS11160 (QUC26_11160) | 2403473..2404726 | + | 1254 | WP_104963084.1 | group II intron reverse transcriptase/maturase | - |
QUC26_RS11165 (QUC26_11165) | 2404800..2405270 | + | 471 | Protein_2166 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11213.69 Da Isoelectric Point: 5.9081
>T284682 WP_003155924.1 NZ_CP128508:2401149-2401442 [Pseudomonas asiatica]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFVRLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTTYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFVRLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTTYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|