Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2605446..2606393 | Replicon | chromosome |
Accession | NZ_CP128507 | ||
Organism | Pseudomonas aeruginosa strain WS27-3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QUC27_RS12430 | Protein ID | WP_289360052.1 |
Coordinates | 2606214..2606393 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QUC27_RS12425 | Protein ID | WP_228214486.1 |
Coordinates | 2605446..2606168 (-) | Length | 241 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC27_RS12390 (QUC27_12390) | 2600834..2601052 | + | 219 | WP_003451709.1 | Cro/CI family transcriptional regulator | - |
QUC27_RS12395 (QUC27_12395) | 2601292..2601783 | - | 492 | WP_171941815.1 | hypothetical protein | - |
QUC27_RS12400 (QUC27_12400) | 2601887..2602459 | + | 573 | WP_289360048.1 | hypothetical protein | - |
QUC27_RS12405 (QUC27_12405) | 2602462..2603346 | + | 885 | WP_289360049.1 | hypothetical protein | - |
QUC27_RS12410 (QUC27_12410) | 2603249..2604004 | + | 756 | WP_289360050.1 | replication protein P | - |
QUC27_RS12415 (QUC27_12415) | 2603997..2604446 | + | 450 | WP_128723289.1 | RusA family crossover junction endodeoxyribonuclease | - |
QUC27_RS12420 (QUC27_12420) | 2604475..2605344 | + | 870 | WP_128723290.1 | hypothetical protein | - |
QUC27_RS12425 (QUC27_12425) | 2605446..2606168 | - | 723 | WP_228214486.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QUC27_RS12430 (QUC27_12430) | 2606214..2606393 | - | 180 | WP_289360052.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QUC27_RS12435 (QUC27_12435) | 2606479..2606859 | + | 381 | WP_033994419.1 | putative holin | - |
QUC27_RS12440 (QUC27_12440) | 2606852..2607175 | + | 324 | WP_050585148.1 | phage holin family protein | - |
QUC27_RS12445 (QUC27_12445) | 2607239..2607427 | + | 189 | WP_003451692.1 | DUF2158 domain-containing protein | - |
QUC27_RS12450 (QUC27_12450) | 2607471..2608052 | + | 582 | WP_289360055.1 | terminase small subunit | - |
QUC27_RS12455 (QUC27_12455) | 2608049..2609374 | + | 1326 | WP_213910750.1 | terminase family protein | - |
QUC27_RS12460 (QUC27_12460) | 2609377..2610732 | + | 1356 | WP_003451684.1 | DUF4055 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2581040..2635179 | 54139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6618.69 Da Isoelectric Point: 11.4350
>T284678 WP_289360052.1 NZ_CP128507:c2606393-2606214 [Pseudomonas aeruginosa]
MKFSEFRRWLRAQGVTFEAGKGSHFKITAPNGKTTTFANHGAKEMPEPTRKAIIKQLGL
MKFSEFRRWLRAQGVTFEAGKGSHFKITAPNGKTTTFANHGAKEMPEPTRKAIIKQLGL
Download Length: 180 bp
Antitoxin
Download Length: 241 a.a. Molecular weight: 27041.54 Da Isoelectric Point: 4.7445
>AT284678 WP_228214486.1 NZ_CP128507:c2606168-2605446 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSFGDDREHAIQEAMDAIETTLSLYVDARKPIPEATPPEEGEHVVHLPAVTVA
KIALWNEMMKRGMRKSDLCKLLGIAQTQGDRLVDFLHNTKMDAVEAALLALGTRLRQSVEVRFDWVKLRHERADDVILVE
VWCEMVSSGHDETGNEQGWVSLPSQLSTTWNQIKAMEAHQFATGRQFSISVDDDRPGESRFESLGRIHLPVTFYAARVSA
MYDYAIRFEQDDSAPGVAVFCRDLPELNSFGDDREHAIQEAMDAIETTLSLYVDARKPIPEATPPEEGEHVVHLPAVTVA
KIALWNEMMKRGMRKSDLCKLLGIAQTQGDRLVDFLHNTKMDAVEAALLALGTRLRQSVEVRFDWVKLRHERADDVILVE
VWCEMVSSGHDETGNEQGWVSLPSQLSTTWNQIKAMEAHQFATGRQFSISVDDDRPGESRFESLGRIHLPVTFYAARVSA
Download Length: 723 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|