Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 145746..146251 | Replicon | chromosome |
Accession | NZ_CP128507 | ||
Organism | Pseudomonas aeruginosa strain WS27-3 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | QUC27_RS00675 | Protein ID | WP_003121619.1 |
Coordinates | 145746..146027 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | QUC27_RS00680 | Protein ID | WP_003112628.1 |
Coordinates | 146024..146251 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC27_RS00650 (QUC27_00650) | 140997..142346 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
QUC27_RS00655 (QUC27_00655) | 142395..143081 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
QUC27_RS00660 (QUC27_00660) | 143182..143916 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
QUC27_RS00665 (QUC27_00665) | 144096..144506 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
QUC27_RS00670 (QUC27_00670) | 144538..145446 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
QUC27_RS00675 (QUC27_00675) | 145746..146027 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
QUC27_RS00680 (QUC27_00680) | 146024..146251 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QUC27_RS00685 (QUC27_00685) | 146427..147047 | - | 621 | WP_003101226.1 | hypothetical protein | - |
QUC27_RS00690 (QUC27_00690) | 147148..147648 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
QUC27_RS00695 (QUC27_00695) | 147721..148062 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
QUC27_RS00700 (QUC27_00700) | 148144..149571 | - | 1428 | WP_003083784.1 | GABA permease | - |
QUC27_RS00705 (QUC27_00705) | 149740..151233 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T284676 WP_003121619.1 NZ_CP128507:c146027-145746 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6XRW | |
AlphaFold DB | Q9I707 |