Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 158684..159189 | Replicon | chromosome |
Accession | NZ_CP128506 | ||
Organism | Pseudomonas aeruginosa strain Fe11-1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | QUC24_RS00750 | Protein ID | WP_003083773.1 |
Coordinates | 158684..158965 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | QUC24_RS00755 | Protein ID | WP_003083775.1 |
Coordinates | 158962..159189 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC24_RS00725 (QUC24_00725) | 153935..155284 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
QUC24_RS00730 (QUC24_00730) | 155333..156019 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
QUC24_RS00735 (QUC24_00735) | 156120..156854 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
QUC24_RS00740 (QUC24_00740) | 157034..157444 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
QUC24_RS00745 (QUC24_00745) | 157476..158384 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
QUC24_RS00750 (QUC24_00750) | 158684..158965 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
QUC24_RS00755 (QUC24_00755) | 158962..159189 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QUC24_RS00760 (QUC24_00760) | 159365..159985 | - | 621 | WP_003101226.1 | hypothetical protein | - |
QUC24_RS00765 (QUC24_00765) | 160086..160586 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
QUC24_RS00770 (QUC24_00770) | 160659..161000 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
QUC24_RS00775 (QUC24_00775) | 161082..162509 | - | 1428 | WP_031630494.1 | GABA permease | - |
QUC24_RS00780 (QUC24_00780) | 162678..164171 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T284671 WP_003083773.1 NZ_CP128506:c158965-158684 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|