Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3513608..3514245 | Replicon | chromosome |
Accession | NZ_CP128504 | ||
Organism | Bacillus velezensis strain SRCM123434 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QTN49_RS17495 | Protein ID | WP_003156187.1 |
Coordinates | 3513608..3513958 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QTN49_RS17500 | Protein ID | WP_003156188.1 |
Coordinates | 3513964..3514245 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN49_RS17455 (3508648) | 3508648..3509250 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
QTN49_RS17460 (3509250) | 3509250..3510038 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QTN49_RS17465 (3510004) | 3510004..3510486 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
QTN49_RS17470 (3510483) | 3510483..3510812 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
QTN49_RS17475 (3510876) | 3510876..3511883 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
QTN49_RS17480 (3511895) | 3511895..3512296 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
QTN49_RS17485 (3512299) | 3512299..3512664 | - | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
QTN49_RS17490 (3512669) | 3512669..3513490 | - | 822 | WP_025649964.1 | STAS domain-containing protein | - |
QTN49_RS17495 (3513608) | 3513608..3513958 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QTN49_RS17500 (3513964) | 3513964..3514245 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QTN49_RS17505 (3514365) | 3514365..3515534 | - | 1170 | WP_104843106.1 | alanine racemase | - |
QTN49_RS17510 (3515651) | 3515651..3516658 | - | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
QTN49_RS17515 (3516823) | 3516823..3517188 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
QTN49_RS17520 (3517281) | 3517281..3517880 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284664 WP_003156187.1 NZ_CP128504:c3513958-3513608 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|