Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2720047..2720964 | Replicon | chromosome |
Accession | NZ_CP128504 | ||
Organism | Bacillus velezensis strain SRCM123434 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QTN49_RS13280 | Protein ID | WP_263611996.1 |
Coordinates | 2720047..2720793 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | QTN49_RS13285 | Protein ID | WP_003154807.1 |
Coordinates | 2720794..2720964 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN49_RS13260 (2715441) | 2715441..2716391 | - | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
QTN49_RS13265 (2716713) | 2716713..2718029 | + | 1317 | WP_007610842.1 | amino acid permease | - |
QTN49_RS13270 (2718315) | 2718315..2718932 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
QTN49_RS13275 (2718945) | 2718945..2719943 | + | 999 | WP_017417610.1 | inorganic phosphate transporter | - |
QTN49_RS13280 (2720047) | 2720047..2720793 | + | 747 | WP_263611996.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QTN49_RS13285 (2720794) | 2720794..2720964 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QTN49_RS13290 (2721061) | 2721061..2721186 | + | 126 | WP_003154809.1 | hypothetical protein | - |
QTN49_RS13295 (2721221) | 2721221..2722099 | - | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
QTN49_RS13300 (2722113) | 2722113..2722376 | - | 264 | WP_003154813.1 | phage holin | - |
QTN49_RS13305 (2722390) | 2722390..2722653 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
QTN49_RS13310 (2722704) | 2722704..2723465 | - | 762 | WP_017417609.1 | hypothetical protein | - |
QTN49_RS13315 (2723522) | 2723522..2723719 | - | 198 | WP_007610833.1 | XkdX family protein | - |
QTN49_RS13320 (2723724) | 2723724..2724095 | - | 372 | WP_017417608.1 | XkdW family protein | - |
QTN49_RS13325 (2724108) | 2724108..2724470 | - | 363 | WP_014721043.1 | hypothetical protein | - |
QTN49_RS13330 (2724581) | 2724581..2725132 | - | 552 | Protein_2627 | terminase | - |
QTN49_RS13335 (2725245) | 2725245..2725757 | - | 513 | WP_017417605.1 | sigma-70 family RNA polymerase sigma factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29107.60 Da Isoelectric Point: 4.7755
>T284663 WP_263611996.1 NZ_CP128504:2720047-2720793 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDTADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDTADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|