Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3762490..3763127 | Replicon | chromosome |
Accession | NZ_CP128503 | ||
Organism | Bacillus velezensis strain SRCM123422 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QTN48_RS19410 | Protein ID | WP_003156187.1 |
Coordinates | 3762490..3762840 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QTN48_RS19415 | Protein ID | WP_003156188.1 |
Coordinates | 3762846..3763127 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN48_RS19370 (3757530) | 3757530..3758132 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
QTN48_RS19375 (3758132) | 3758132..3758920 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QTN48_RS19380 (3758886) | 3758886..3759368 | - | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
QTN48_RS19385 (3759365) | 3759365..3759694 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
QTN48_RS19390 (3759758) | 3759758..3760765 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
QTN48_RS19395 (3760777) | 3760777..3761178 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
QTN48_RS19400 (3761181) | 3761181..3761546 | - | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
QTN48_RS19405 (3761551) | 3761551..3762372 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
QTN48_RS19410 (3762490) | 3762490..3762840 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QTN48_RS19415 (3762846) | 3762846..3763127 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QTN48_RS19420 (3763247) | 3763247..3764416 | - | 1170 | WP_063636967.1 | alanine racemase | - |
QTN48_RS19425 (3764533) | 3764533..3765540 | - | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
QTN48_RS19430 (3765705) | 3765705..3766070 | - | 366 | WP_014304402.1 | holo-ACP synthase | - |
QTN48_RS19435 (3766163) | 3766163..3766762 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284662 WP_003156187.1 NZ_CP128503:c3762840-3762490 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|