Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 2903111..2904028 | Replicon | chromosome |
| Accession | NZ_CP128503 | ||
| Organism | Bacillus velezensis strain SRCM123422 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | QTN48_RS14725 | Protein ID | WP_007407256.1 |
| Coordinates | 2903111..2903857 (+) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | QTN48_RS14730 | Protein ID | WP_003154807.1 |
| Coordinates | 2903858..2904028 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTN48_RS14705 (2898514) | 2898514..2899449 | - | 936 | WP_237586758.1 | ring-cleaving dioxygenase | - |
| QTN48_RS14710 (2899776) | 2899776..2901092 | + | 1317 | WP_007610842.1 | amino acid permease | - |
| QTN48_RS14715 (2901379) | 2901379..2901996 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| QTN48_RS14720 (2902009) | 2902009..2903007 | + | 999 | WP_017417610.1 | inorganic phosphate transporter | - |
| QTN48_RS14725 (2903111) | 2903111..2903857 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QTN48_RS14730 (2903858) | 2903858..2904028 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| QTN48_RS14735 (2904125) | 2904125..2904250 | + | 126 | WP_003154809.1 | hypothetical protein | - |
| QTN48_RS14740 (2904285) | 2904285..2905163 | - | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QTN48_RS14745 (2905177) | 2905177..2905440 | - | 264 | WP_003154813.1 | phage holin | - |
| QTN48_RS14750 (2905454) | 2905454..2905717 | - | 264 | WP_021493821.1 | hemolysin XhlA family protein | - |
| QTN48_RS14755 (2905769) | 2905769..2906530 | - | 762 | WP_025649639.1 | hypothetical protein | - |
| QTN48_RS14760 (2906587) | 2906587..2906784 | - | 198 | WP_007610833.1 | XkdX family protein | - |
| QTN48_RS14765 (2906789) | 2906789..2907160 | - | 372 | WP_017417608.1 | XkdW family protein | - |
| QTN48_RS14770 (2907173) | 2907173..2907535 | - | 363 | WP_014721043.1 | hypothetical protein | - |
| QTN48_RS14775 (2907646) | 2907646..2908197 | - | 552 | Protein_2915 | terminase | - |
| QTN48_RS14780 (2908310) | 2908310..2908822 | - | 513 | WP_017417605.1 | sigma-70 family RNA polymerase sigma factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T284661 WP_007407256.1 NZ_CP128503:2903111-2903857 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|