Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 337906..338543 | Replicon | chromosome |
Accession | NZ_CP128501 | ||
Organism | Bacillus amyloliquefaciens strain SRCM123386 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QTN46_RS01665 | Protein ID | WP_003156187.1 |
Coordinates | 338193..338543 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QTN46_RS01660 | Protein ID | WP_003156188.1 |
Coordinates | 337906..338187 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN46_RS01640 (334272) | 334272..334871 | - | 600 | WP_289394151.1 | rhomboid family intramembrane serine protease | - |
QTN46_RS01645 (334964) | 334964..335329 | + | 366 | WP_289394152.1 | holo-ACP synthase | - |
QTN46_RS01650 (335494) | 335494..336501 | + | 1008 | WP_289394153.1 | outer membrane lipoprotein carrier protein LolA | - |
QTN46_RS01655 (336618) | 336618..337787 | + | 1170 | WP_289394154.1 | alanine racemase | - |
QTN46_RS01660 (337906) | 337906..338187 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QTN46_RS01665 (338193) | 338193..338543 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QTN46_RS01670 (338664) | 338664..339485 | + | 822 | WP_289394155.1 | STAS domain-containing protein | - |
QTN46_RS01675 (339490) | 339490..339855 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
QTN46_RS01680 (339858) | 339858..340259 | + | 402 | WP_013351097.1 | anti-sigma regulatory factor | - |
QTN46_RS01685 (340271) | 340271..341278 | + | 1008 | WP_013351098.1 | PP2C family protein-serine/threonine phosphatase | - |
QTN46_RS01690 (341342) | 341342..341671 | + | 330 | WP_014469786.1 | anti-sigma factor antagonist | - |
QTN46_RS01695 (341668) | 341668..342150 | + | 483 | WP_013351100.1 | anti-sigma B factor RsbW | - |
QTN46_RS01700 (342116) | 342116..342904 | + | 789 | WP_013351101.1 | RNA polymerase sigma factor SigB | - |
QTN46_RS01705 (342904) | 342904..343506 | + | 603 | WP_013351102.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284655 WP_003156187.1 NZ_CP128501:338193-338543 [Bacillus amyloliquefaciens]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|