Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3358199..3358836 | Replicon | chromosome |
Accession | NZ_CP128500 | ||
Organism | Bacillus amyloliquefaciens strain SRCM123364 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QTN45_RS17330 | Protein ID | WP_003156187.1 |
Coordinates | 3358199..3358549 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QTN45_RS17335 | Protein ID | WP_003156188.1 |
Coordinates | 3358555..3358836 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN45_RS17290 (QTN45_17290) | 3353236..3353838 | - | 603 | WP_013351102.1 | PP2C family serine/threonine-protein phosphatase | - |
QTN45_RS17295 (QTN45_17295) | 3353838..3354626 | - | 789 | WP_013351101.1 | RNA polymerase sigma factor SigB | - |
QTN45_RS17300 (QTN45_17300) | 3354592..3355074 | - | 483 | WP_013351100.1 | anti-sigma B factor RsbW | - |
QTN45_RS17305 (QTN45_17305) | 3355071..3355400 | - | 330 | WP_014469786.1 | anti-sigma factor antagonist | - |
QTN45_RS17310 (QTN45_17310) | 3355464..3356471 | - | 1008 | WP_013351098.1 | PP2C family protein-serine/threonine phosphatase | - |
QTN45_RS17315 (QTN45_17315) | 3356483..3356884 | - | 402 | WP_013351097.1 | anti-sigma regulatory factor | - |
QTN45_RS17320 (QTN45_17320) | 3356887..3357252 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
QTN45_RS17325 (QTN45_17325) | 3357257..3358078 | - | 822 | WP_013351096.1 | STAS domain-containing protein | - |
QTN45_RS17330 (QTN45_17330) | 3358199..3358549 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QTN45_RS17335 (QTN45_17335) | 3358555..3358836 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QTN45_RS17340 (QTN45_17340) | 3358955..3360124 | - | 1170 | WP_013351095.1 | alanine racemase | - |
QTN45_RS17345 (QTN45_17345) | 3360241..3361248 | - | 1008 | WP_013351094.1 | outer membrane lipoprotein carrier protein LolA | - |
QTN45_RS17350 (QTN45_17350) | 3361413..3361778 | - | 366 | WP_013351093.1 | holo-ACP synthase | - |
QTN45_RS17355 (QTN45_17355) | 3361871..3362470 | + | 600 | WP_013351092.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284654 WP_003156187.1 NZ_CP128500:c3358549-3358199 [Bacillus amyloliquefaciens]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|