Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 1373128..1373726 Replicon chromosome
Accession NZ_CP128494
Organism Geobacillus stearothermophilus ATCC 12980

Toxin (Protein)


Gene name mazF Uniprot ID A0A0K9HME7
Locus tag QSJ10_RS07390 Protein ID WP_033016743.1
Coordinates 1373397..1373726 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A7U9J7G7
Locus tag QSJ10_RS07385 Protein ID WP_023634676.1
Coordinates 1373128..1373397 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSJ10_RS07345 (QSJ10_07345) 1368633..1368920 + 288 WP_049624307.1 transporter suffix domain-containing protein -
QSJ10_RS07350 (QSJ10_07350) 1368938..1369735 + 798 WP_053532805.1 SGNH/GDSL hydrolase family protein -
QSJ10_RS07355 (QSJ10_07355) 1369732..1370646 + 915 WP_053532806.1 ABC transporter ATP-binding protein -
QSJ10_RS07360 (QSJ10_07360) 1370639..1371619 + 981 WP_033016739.1 ABC transporter permease -
QSJ10_RS07365 (QSJ10_07365) 1371890..1372438 - 549 WP_230581392.1 hypothetical protein -
QSJ10_RS07385 (QSJ10_07385) 1373128..1373397 + 270 WP_023634676.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
QSJ10_RS07390 (QSJ10_07390) 1373397..1373726 + 330 WP_033016743.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QSJ10_RS07395 (QSJ10_07395) 1373919..1374113 + 195 Protein_1391 pirin-like C-terminal cupin domain-containing protein -
QSJ10_RS07400 (QSJ10_07400) 1374209..1374958 + 750 WP_033016745.1 oxygen-insensitive NADPH nitroreductase -
QSJ10_RS07405 (QSJ10_07405) 1375032..1375775 + 744 WP_033016746.1 NAD-dependent protein deacylase -
QSJ10_RS07410 (QSJ10_07410) 1375809..1376477 + 669 Protein_1394 branched-chain amino acid ABC transporter permease -
QSJ10_RS07415 (QSJ10_07415) 1376477..1376605 + 129 WP_259463347.1 hypothetical protein -
QSJ10_RS07420 (QSJ10_07420) 1376749..1376991 + 243 Protein_1396 multidrug resistance efflux transporter family protein -
QSJ10_RS07425 (QSJ10_07425) 1377627..1378133 - 507 WP_033014176.1 QueT transporter family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-105)

Antitoxin

SpoVT-AbrB domain

(17-61)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12043.80 Da        Isoelectric Point: 6.4485

>T284652 WP_033016743.1 NZ_CP128494:1373397-1373726 [Geobacillus stearothermophilus ATCC 12980]
MQAPDRGDLVYVNFNPQAGHEQAGKRPGIVLSPKRFNQLTGFAVLCPITQQQKGYPFEVELPSGLAVEGVILTDQVKSLD
WRARQLQIVGRAPNEVVSDCLDLIHTFLS

Download         Length: 330 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 9928.55 Da        Isoelectric Point: 7.2050

>AT284652 WP_023634676.1 NZ_CP128494:1373128-1373397 [Geobacillus stearothermophilus ATCC 12980]
VELNKQKGVSIMTITVQKWGNSLAVRIPSVIAERLALHQGSEVEVIVENQAIKLIPKKKKPTLEELLAKITPENRHAEID
FGTEGNELF

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9HME7

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9J7G7

References