Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 210500..211136 | Replicon | chromosome |
Accession | NZ_CP128494 | ||
Organism | Geobacillus stearothermophilus ATCC 12980 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | L7ZVP1 |
Locus tag | QSJ10_RS01170 | Protein ID | WP_003253417.1 |
Coordinates | 210786..211136 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A087LE06 |
Locus tag | QSJ10_RS01165 | Protein ID | WP_033010302.1 |
Coordinates | 210500..210781 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSJ10_RS01145 (QSJ10_01145) | 206750..207367 | - | 618 | WP_053532150.1 | rhomboid family intramembrane serine protease | - |
QSJ10_RS01150 (QSJ10_01150) | 207486..207875 | + | 390 | WP_033010299.1 | holo-ACP synthase | - |
QSJ10_RS01155 (QSJ10_01155) | 207956..208975 | + | 1020 | WP_033016553.1 | outer membrane lipoprotein carrier protein LolA | - |
QSJ10_RS01160 (QSJ10_01160) | 209219..210385 | + | 1167 | WP_053532153.1 | alanine racemase | - |
QSJ10_RS01165 (QSJ10_01165) | 210500..210781 | + | 282 | WP_033010302.1 | hypothetical protein | Antitoxin |
QSJ10_RS01170 (QSJ10_01170) | 210786..211136 | + | 351 | WP_003253417.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QSJ10_RS01175 (QSJ10_01175) | 211679..213841 | + | 2163 | WP_049624463.1 | Tex family protein | - |
QSJ10_RS01180 (QSJ10_01180) | 213899..214012 | - | 114 | WP_121625977.1 | cortex morphogenetic protein CmpA | - |
QSJ10_RS01185 (QSJ10_01185) | 214106..214567 | + | 462 | WP_033016555.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12992.00 Da Isoelectric Point: 4.8781
>T284649 WP_003253417.1 NZ_CP128494:210786-211136 [Geobacillus stearothermophilus ATCC 12980]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9ERQ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087LE06 |