Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 396744..397357 | Replicon | plasmid pHR1a |
Accession | NZ_CP128493 | ||
Organism | Novosphingobium resinovorum strain HR1a |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QUC32_RS28745 | Protein ID | WP_211152191.1 |
Coordinates | 397070..397357 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A1D8AFB2 |
Locus tag | QUC32_RS28740 | Protein ID | WP_069710097.1 |
Coordinates | 396744..397031 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC32_RS28715 (QUC32_28715) | 392071..393453 | + | 1383 | WP_289357792.1 | hypothetical protein | - |
QUC32_RS28720 (QUC32_28720) | 393468..394001 | - | 534 | WP_211152190.1 | hypothetical protein | - |
QUC32_RS28725 (QUC32_28725) | 394728..394952 | - | 225 | WP_069710095.1 | hypothetical protein | - |
QUC32_RS28730 (QUC32_28730) | 395354..395779 | + | 426 | WP_069710096.1 | hypothetical protein | - |
QUC32_RS28735 (QUC32_28735) | 395965..396285 | - | 321 | WP_008832418.1 | DUF736 family protein | - |
QUC32_RS28740 (QUC32_28740) | 396744..397031 | - | 288 | WP_069710097.1 | putative addiction module antidote protein | Antitoxin |
QUC32_RS28745 (QUC32_28745) | 397070..397357 | - | 288 | WP_211152191.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QUC32_RS28750 (QUC32_28750) | 397602..399431 | - | 1830 | WP_211152192.1 | ParB/RepB/Spo0J family partition protein | - |
QUC32_RS28755 (QUC32_28755) | 399523..399903 | - | 381 | WP_231958527.1 | DUF2958 domain-containing protein | - |
QUC32_RS28760 (QUC32_28760) | 399930..400949 | - | 1020 | WP_211152193.1 | zincin-like metallopeptidase domain-containing protein | - |
QUC32_RS28765 (QUC32_28765) | 401471..401845 | + | 375 | WP_248006466.1 | thermonuclease family protein | - |
QUC32_RS28770 (QUC32_28770) | 402126..402290 | + | 165 | WP_156800016.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB / katA | 1..819262 | 819262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10689.23 Da Isoelectric Point: 10.4170
>T284648 WP_211152191.1 NZ_CP128493:c397357-397070 [Novosphingobium resinovorum]
MEVTQTAVFAQWFHRLRDPKAQSRIAQRIARIEIGLMGDVKSVGDGVSEARIDYGPGYRLYFTRRGDELVILLVGGDKSS
QQRDIARARQLAAQL
MEVTQTAVFAQWFHRLRDPKAQSRIAQRIARIEIGLMGDVKSVGDGVSEARIDYGPGYRLYFTRRGDELVILLVGGDKSS
QQRDIARARQLAAQL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|