Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 127326..127830 | Replicon | plasmid pHR1a |
Accession | NZ_CP128493 | ||
Organism | Novosphingobium resinovorum strain HR1a |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | QUC32_RS27405 | Protein ID | WP_211152060.1 |
Coordinates | 127326..127619 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | T0IKR4 |
Locus tag | QUC32_RS27410 | Protein ID | WP_021235306.1 |
Coordinates | 127603..127830 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC32_RS27395 (QUC32_27395) | 125073..125966 | + | 894 | WP_211152059.1 | SDR family oxidoreductase | - |
QUC32_RS27400 (QUC32_27400) | 126813..127274 | - | 462 | WP_008828892.1 | hypothetical protein | - |
QUC32_RS27405 (QUC32_27405) | 127326..127619 | - | 294 | WP_211152060.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QUC32_RS27410 (QUC32_27410) | 127603..127830 | - | 228 | WP_021235306.1 | DUF6290 family protein | Antitoxin |
QUC32_RS27415 (QUC32_27415) | 127886..128395 | - | 510 | WP_211152061.1 | hypothetical protein | - |
QUC32_RS27420 (QUC32_27420) | 128412..128561 | - | 150 | WP_248006420.1 | hypothetical protein | - |
QUC32_RS27425 (QUC32_27425) | 128623..129366 | - | 744 | WP_289357715.1 | hypothetical protein | - |
QUC32_RS27430 (QUC32_27430) | 129596..129871 | + | 276 | WP_008830594.1 | hypothetical protein | - |
QUC32_RS27435 (QUC32_27435) | 131022..131405 | + | 384 | WP_008830595.1 | transposase | - |
QUC32_RS27440 (QUC32_27440) | 131712..131999 | - | 288 | WP_008830597.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB / katA | 1..819262 | 819262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10874.57 Da Isoelectric Point: 10.0135
>T284647 WP_211152060.1 NZ_CP128493:c127619-127326 [Novosphingobium resinovorum]
MAWRIELSSSAEKSLSKLDCQTAKRIITFPRERVAAGEDPRASGKPLSGPLAGRWRYRVGDYRIVCEIEDGRLVVLVLTV
GHRSGIYRCPPKDIHNP
MAWRIELSSSAEKSLSKLDCQTAKRIITFPRERVAAGEDPRASGKPLSGPLAGRWRYRVGDYRIVCEIEDGRLVVLVLTV
GHRSGIYRCPPKDIHNP
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|