Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5208787..5209412 | Replicon | chromosome |
Accession | NZ_CP128487 | ||
Organism | Klebsiella pneumoniae strain YZEF2-2C |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A483GDF6 |
Locus tag | QTN20_RS27530 | Protein ID | WP_004187928.1 |
Coordinates | 5208787..5209170 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | QTN20_RS27535 | Protein ID | WP_004150355.1 |
Coordinates | 5209170..5209412 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN20_RS27515 (5206153) | 5206153..5207055 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
QTN20_RS27520 (5207052) | 5207052..5207687 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
QTN20_RS27525 (5207684) | 5207684..5208613 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
QTN20_RS27530 (5208787) | 5208787..5209170 | - | 384 | WP_004187928.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QTN20_RS27535 (5209170) | 5209170..5209412 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
QTN20_RS27540 (5209606) | 5209606..5210523 | + | 918 | WP_032437488.1 | alpha/beta hydrolase | - |
QTN20_RS27545 (5210537) | 5210537..5211478 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
QTN20_RS27550 (5211523) | 5211523..5211960 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
QTN20_RS27555 (5211957) | 5211957..5212817 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
QTN20_RS27560 (5212811) | 5212811..5213410 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14407.64 Da Isoelectric Point: 7.3178
>T284645 WP_004187928.1 NZ_CP128487:c5209170-5208787 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GDF6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |