Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4720199..4720715 | Replicon | chromosome |
Accession | NZ_CP128487 | ||
Organism | Klebsiella pneumoniae strain YZEF2-2C |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A486Q7B5 |
Locus tag | QTN20_RS25210 | Protein ID | WP_004192395.1 |
Coordinates | 4720199..4720483 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A483GCT9 |
Locus tag | QTN20_RS25215 | Protein ID | WP_004192397.1 |
Coordinates | 4720473..4720715 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN20_RS25185 (4715616) | 4715616..4715879 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
QTN20_RS25190 (4716009) | 4716009..4716182 | + | 174 | WP_002886906.1 | hypothetical protein | - |
QTN20_RS25195 (4716185) | 4716185..4716928 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
QTN20_RS25200 (4717285) | 4717285..4719423 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QTN20_RS25205 (4719731) | 4719731..4720195 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QTN20_RS25210 (4720199) | 4720199..4720483 | - | 285 | WP_004192395.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QTN20_RS25215 (4720473) | 4720473..4720715 | - | 243 | WP_004192397.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QTN20_RS25220 (4720793) | 4720793..4722703 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
QTN20_RS25225 (4722726) | 4722726..4723880 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
QTN20_RS25230 (4723947) | 4723947..4724687 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11184.03 Da Isoelectric Point: 10.3787
>T284643 WP_004192395.1 NZ_CP128487:c4720483-4720199 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486Q7B5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GCT9 |