Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4597331..4598141 | Replicon | chromosome |
Accession | NZ_CP128487 | ||
Organism | Klebsiella pneumoniae strain YZEF2-2C |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A483G813 |
Locus tag | QTN20_RS24610 | Protein ID | WP_023279404.1 |
Coordinates | 4597331..4597864 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | QTN20_RS24615 | Protein ID | WP_002887278.1 |
Coordinates | 4597875..4598141 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN20_RS24605 (4596162) | 4596162..4597283 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
QTN20_RS24610 (4597331) | 4597331..4597864 | - | 534 | WP_023279404.1 | type II toxin-antitoxin system toxin KacT | Toxin |
QTN20_RS24615 (4597875) | 4597875..4598141 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
QTN20_RS24620 (4598244) | 4598244..4599677 | - | 1434 | WP_004192214.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
QTN20_RS24625 (4599667) | 4599667..4600350 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
QTN20_RS24630 (4600522) | 4600522..4601907 | + | 1386 | WP_004192218.1 | efflux transporter outer membrane subunit | - |
QTN20_RS24635 (4601925) | 4601925..4602269 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19809.71 Da Isoelectric Point: 6.2369
>T284642 WP_023279404.1 NZ_CP128487:c4597864-4597331 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483G813 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |