Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3998365..3998984 Replicon chromosome
Accession NZ_CP128487
Organism Klebsiella pneumoniae strain YZEF2-2C

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QTN20_RS21745 Protein ID WP_002892050.1
Coordinates 3998766..3998984 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QTN20_RS21740 Protein ID WP_002892066.1
Coordinates 3998365..3998739 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTN20_RS21730 (3993517) 3993517..3994710 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QTN20_RS21735 (3994733) 3994733..3997879 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QTN20_RS21740 (3998365) 3998365..3998739 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QTN20_RS21745 (3998766) 3998766..3998984 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QTN20_RS21750 (3999143) 3999143..3999709 + 567 WP_004191639.1 maltose O-acetyltransferase -
QTN20_RS21755 (3999681) 3999681..3999821 - 141 WP_004147370.1 hypothetical protein -
QTN20_RS21760 (3999842) 3999842..4000312 + 471 WP_002892026.1 YlaC family protein -
QTN20_RS21765 (4000287) 4000287..4001738 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QTN20_RS21770 (4001839) 4001839..4002537 + 699 WP_002892021.1 GNAT family protein -
QTN20_RS21775 (4002534) 4002534..4002674 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QTN20_RS21780 (4002674) 4002674..4002937 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T284641 WP_002892050.1 NZ_CP128487:3998766-3998984 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT284641 WP_002892066.1 NZ_CP128487:3998365-3998739 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References