Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 90298..91208 | Replicon | plasmid pYZEF2-2C_tmex |
Accession | NZ_CP128484 | ||
Organism | Klebsiella pneumoniae strain YZEF2-2C |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | QTN20_RS00465 | Protein ID | WP_032413375.1 |
Coordinates | 90298..90768 (-) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A7H4PRG4 |
Locus tag | QTN20_RS00470 | Protein ID | WP_032413443.1 |
Coordinates | 90765..91208 (-) | Length | 148 a.a. |
Genomic Context
Location: 86177..86269 (93 bp)
Type: Others
Protein ID: Protein_85
Type: Others
Protein ID: Protein_85
Location: 87005..87160 (156 bp)
Type: Others
Protein ID: Protein_86
Type: Others
Protein ID: Protein_86
Location: 88979..89356 (378 bp)
Type: Others
Protein ID: Protein_90
Type: Others
Protein ID: Protein_90
Location: 89928..90188 (261 bp)
Type: Others
Protein ID: WP_017901409.1
Type: Others
Protein ID: WP_017901409.1
Location: 92126..92707 (582 bp)
Type: Others
Protein ID: WP_077254766.1
Type: Others
Protein ID: WP_077254766.1
Location: 93794..94762 (969 bp)
Type: Others
Protein ID: WP_077268726.1
Type: Others
Protein ID: WP_077268726.1
Location: 94853..95524 (672 bp)
Type: Others
Protein ID: WP_159226239.1
Type: Others
Protein ID: WP_159226239.1
Location: 85599..86135 (537 bp)
Type: Others
Protein ID: WP_032437437.1
Type: Others
Protein ID: WP_032437437.1
Location: 87101..87628 (528 bp)
Type: Others
Protein ID: WP_224707344.1
Type: Others
Protein ID: WP_224707344.1
Location: 87639..88589 (951 bp)
Type: Others
Protein ID: WP_077268727.1
Type: Others
Protein ID: WP_077268727.1
Location: 88712..88905 (194 bp)
Type: Others
Protein ID: Protein_89
Type: Others
Protein ID: Protein_89
Location: 90298..90768 (471 bp)
Type: Toxin
Protein ID: WP_032413375.1
Type: Toxin
Protein ID: WP_032413375.1
Location: 90765..91208 (444 bp)
Type: Antitoxin
Protein ID: WP_032413443.1
Type: Antitoxin
Protein ID: WP_032413443.1
Location: 91308..91820 (513 bp)
Type: Others
Protein ID: Protein_94
Type: Others
Protein ID: Protein_94
Location: 91921..92106 (186 bp)
Type: Others
Protein ID: WP_071571073.1
Type: Others
Protein ID: WP_071571073.1
Location: 92830..93378 (549 bp)
Type: Others
Protein ID: WP_023320124.1
Type: Others
Protein ID: WP_023320124.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN20_RS00425 (QTN20_00425) | 85599..86135 | - | 537 | WP_032437437.1 | hypothetical protein | - |
QTN20_RS00430 (QTN20_00430) | 86177..86269 | + | 93 | Protein_85 | hypothetical protein | - |
QTN20_RS00435 (QTN20_00435) | 87005..87160 | + | 156 | Protein_86 | transposase | - |
QTN20_RS00440 (QTN20_00440) | 87101..87628 | - | 528 | WP_224707344.1 | hypothetical protein | - |
QTN20_RS00445 (QTN20_00445) | 87639..88589 | - | 951 | WP_077268727.1 | IS5-like element IS903B family transposase | - |
QTN20_RS00450 (QTN20_00450) | 88712..88905 | - | 194 | Protein_89 | transposase | - |
QTN20_RS00455 (QTN20_00455) | 88979..89356 | + | 378 | Protein_90 | integrase core domain-containing protein | - |
QTN20_RS00460 (QTN20_00460) | 89928..90188 | + | 261 | WP_017901409.1 | hypothetical protein | - |
QTN20_RS00465 (QTN20_00465) | 90298..90768 | - | 471 | WP_032413375.1 | RES family NAD+ phosphorylase | Toxin |
QTN20_RS00470 (QTN20_00470) | 90765..91208 | - | 444 | WP_032413443.1 | DUF2384 domain-containing protein | Antitoxin |
QTN20_RS00475 (QTN20_00475) | 91308..91820 | - | 513 | Protein_94 | DUF4113 domain-containing protein | - |
QTN20_RS00480 (QTN20_00480) | 91921..92106 | - | 186 | WP_071571073.1 | DUF2188 domain-containing protein | - |
QTN20_RS00485 (QTN20_00485) | 92126..92707 | + | 582 | WP_077254766.1 | transposase | - |
QTN20_RS00490 (QTN20_00490) | 92830..93378 | - | 549 | WP_023320124.1 | GNAT family N-acetyltransferase | - |
QTN20_RS00495 (QTN20_00495) | 93794..94762 | + | 969 | WP_077268726.1 | IS5-like element IS903B family transposase | - |
QTN20_RS00500 (QTN20_00500) | 94853..95524 | + | 672 | WP_159226239.1 | alpha/beta hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3'')-Ib / aph(6)-Id / aph(4)-Ia / aac(3)-IVa / sul3 / ant(3'')-Ia / cmlA1 / aadA2 | - | 1..207962 | 207962 | |
- | inside | IScluster/Tn | - | - | 83120..109985 | 26865 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17547.79 Da Isoelectric Point: 4.5152
>T284631 WP_032413375.1 NZ_CP128484:c90768-90298 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIAFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIAFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16508.82 Da Isoelectric Point: 10.3013
>AT284631 WP_032413443.1 NZ_CP128484:c91208-90765 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H4PRG4 |