Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 26824..27476 Replicon plasmid pYZEF2-2C_tmex
Accession NZ_CP128484
Organism Klebsiella pneumoniae strain YZEF2-2C

Toxin (Protein)


Gene name vagD Uniprot ID A0A8A2Q2K1
Locus tag QTN20_RS00130 Protein ID WP_017901321.1
Coordinates 27051..27476 (+) Length 142 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A853H7M9
Locus tag QTN20_RS00125 Protein ID WP_001261275.1
Coordinates 26824..27054 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTN20_RS00120 (QTN20_00120) 23995..26571 + 2577 WP_017901322.1 nuclease domain-containing protein -
QTN20_RS00125 (QTN20_00125) 26824..27054 + 231 WP_001261275.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QTN20_RS00130 (QTN20_00130) 27051..27476 + 426 WP_017901321.1 type II toxin-antitoxin system VapC family toxin Toxin
QTN20_RS00135 (QTN20_00135) 27494..28462 + 969 WP_236935921.1 IS5 family transposase -
QTN20_RS00140 (QTN20_00140) 28521..29057 + 537 Protein_27 integrase core domain-containing protein -
QTN20_RS00145 (QTN20_00145) 29110..29283 + 174 Protein_28 nuclease -
QTN20_RS00150 (QTN20_00150) 29470..31026 + 1557 WP_025999314.1 sensor domain-containing diguanylate cyclase -
QTN20_RS00155 (QTN20_00155) 31118..31345 - 228 Protein_30 IS3 family transposase -
QTN20_RS00160 (QTN20_00160) 31356..31526 + 171 Protein_31 LysR family transcriptional regulator -
QTN20_RS00165 (QTN20_00165) 31651..31767 - 117 Protein_32 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3'')-Ib / aph(6)-Id / aph(4)-Ia / aac(3)-IVa / sul3 / ant(3'')-Ia / cmlA1 / aadA2 - 1..207962 207962
- flank IS/Tn - - 27494..28462 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15412.91 Da        Isoelectric Point: 7.1364

>T284629 WP_017901321.1 NZ_CP128484:27051-27476 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8707.72 Da        Isoelectric Point: 4.3410

>AT284629 WP_001261275.1 NZ_CP128484:26824-27054 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8A2Q2K1

Antitoxin

Source ID Structure
AlphaFold DB A0A853H7M9

References