Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 4245275..4245818 | Replicon | chromosome |
Accession | NZ_CP128477 | ||
Organism | Rhizobium sp. SSM4.3 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QTL56_RS20135 | Protein ID | WP_245135144.1 |
Coordinates | 4245519..4245818 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QTL56_RS20130 | Protein ID | WP_245135141.1 |
Coordinates | 4245275..4245526 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTL56_RS20115 | 4240384..4242318 | + | 1935 | WP_245135136.1 | DUF2207 domain-containing protein | - |
QTL56_RS20120 | 4242328..4242891 | + | 564 | WP_245135138.1 | hypothetical protein | - |
QTL56_RS20125 | 4243016..4245169 | + | 2154 | WP_245135139.1 | glycine--tRNA ligase subunit beta | - |
QTL56_RS20130 | 4245275..4245526 | + | 252 | WP_245135141.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QTL56_RS20135 | 4245519..4245818 | + | 300 | WP_245135144.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QTL56_RS20140 | 4245815..4246333 | + | 519 | WP_245135145.1 | DUF523 domain-containing protein | - |
QTL56_RS20145 | 4246375..4247031 | + | 657 | WP_245135148.1 | TetR/AcrR family transcriptional regulator | - |
QTL56_RS20150 | 4247047..4248039 | + | 993 | WP_245135149.1 | MDR family oxidoreductase | - |
QTL56_RS20155 | 4248372..4250189 | - | 1818 | WP_245135151.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11380.91 Da Isoelectric Point: 6.7281
>T284628 WP_245135144.1 NZ_CP128477:4245519-4245818 [Rhizobium sp. SSM4.3]
VAEVRLSPAARRDFLDIGDYTRDLWLEAQAERYLRQILGIIADIGTHPFSGGEVGALRQGYRRRRSGSHLSFYIILEDGM
VEVIRIIHERADVSRRLDE
VAEVRLSPAARRDFLDIGDYTRDLWLEAQAERYLRQILGIIADIGTHPFSGGEVGALRQGYRRRRSGSHLSFYIILEDGM
VEVIRIIHERADVSRRLDE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|