Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1821719..1822204 | Replicon | chromosome |
Accession | NZ_CP128470 | ||
Organism | Macrococcus bovicus strain LI0213 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QSV55_RS09940 | Protein ID | WP_133452080.1 |
Coordinates | 1821719..1822060 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QSV55_RS09945 | Protein ID | WP_165983752.1 |
Coordinates | 1822061..1822204 (-) | Length | 48 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV55_RS09915 (QSV55_09940) | 1816800..1818944 | - | 2145 | WP_289650068.1 | Tex family protein | - |
QSV55_RS09920 (QSV55_09945) | 1819007..1819783 | - | 777 | WP_133452084.1 | RNA polymerase sigma factor SigB | - |
QSV55_RS09925 (QSV55_09950) | 1819758..1820231 | - | 474 | WP_133452083.1 | anti-sigma B factor RsbW | - |
QSV55_RS09930 (QSV55_09955) | 1820233..1820556 | - | 324 | WP_133452082.1 | anti-sigma factor antagonist | - |
QSV55_RS09935 (QSV55_09960) | 1820645..1821643 | - | 999 | WP_289651073.1 | PP2C family protein-serine/threonine phosphatase | - |
QSV55_RS09940 (QSV55_09965) | 1821719..1822060 | - | 342 | WP_133452080.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QSV55_RS09945 (QSV55_09970) | 1822061..1822204 | - | 144 | WP_165983752.1 | hypothetical protein | Antitoxin |
QSV55_RS09950 (QSV55_09975) | 1822264..1823394 | - | 1131 | WP_289650069.1 | alanine racemase | - |
QSV55_RS09955 (QSV55_09980) | 1823408..1823755 | - | 348 | WP_289650070.1 | holo-ACP synthase | - |
QSV55_RS09960 (QSV55_09985) | 1823752..1824225 | - | 474 | WP_289650071.1 | PH domain-containing protein | - |
QSV55_RS09965 (QSV55_09990) | 1824212..1825684 | - | 1473 | WP_289650072.1 | PH domain-containing protein | - |
QSV55_RS09970 (QSV55_09995) | 1825677..1826153 | - | 477 | WP_289650073.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12436.45 Da Isoelectric Point: 10.0504
>T284626 WP_133452080.1 NZ_CP128470:c1822060-1821719 [Macrococcus bovicus]
MRRGEVFLADLSPVKGSEQGGKRPVVIIQNDVGNKYSPTVIVAAITAKINKARIPTHVEIGKTNHHLDKDSVILLEQIRT
IDKNRLIEKLTVLSEEKMSEVNQALAISLGLSQ
MRRGEVFLADLSPVKGSEQGGKRPVVIIQNDVGNKYSPTVIVAAITAKINKARIPTHVEIGKTNHHLDKDSVILLEQIRT
IDKNRLIEKLTVLSEEKMSEVNQALAISLGLSQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|