Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
| Location | 60874..61478 | Replicon | plasmid pLI0213a |
| Accession | NZ_CP128469 | ||
| Organism | Macrococcus bovicus strain LI0213 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | QSV55_RS00400 | Protein ID | WP_289649408.1 |
| Coordinates | 61131..61478 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | QSV55_RS00395 | Protein ID | WP_289649407.1 |
| Coordinates | 60874..61137 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV55_RS00380 (QSV55_00380) | 56057..59857 | + | 3801 | WP_289649404.1 | hypothetical protein | - |
| QSV55_RS00385 (QSV55_00385) | 59908..60231 | + | 324 | WP_289649405.1 | DUF5592 family protein | - |
| QSV55_RS00390 (QSV55_00390) | 60231..60818 | + | 588 | WP_289649406.1 | hypothetical protein | - |
| QSV55_RS00395 (QSV55_00395) | 60874..61137 | + | 264 | WP_289649407.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QSV55_RS00400 (QSV55_00400) | 61131..61478 | + | 348 | WP_289649408.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QSV55_RS00405 (QSV55_00405) | 61632..63614 | + | 1983 | WP_289649409.1 | hypothetical protein | - |
| QSV55_RS00410 (QSV55_00410) | 63631..64086 | + | 456 | WP_289649410.1 | hypothetical protein | - |
| QSV55_RS00415 (QSV55_00415) | 64162..65301 | + | 1140 | WP_289649411.1 | CHAP domain-containing protein | - |
| QSV55_RS00420 (QSV55_00420) | 65314..65916 | + | 603 | WP_289649412.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..66682 | 66682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13140.01 Da Isoelectric Point: 5.6262
>T284625 WP_289649408.1 NZ_CP128469:61131-61478 [Macrococcus bovicus]
MVSKVSQGDIFYVNFNPSRGHEQKNHRPALAISHDMVRDNSDMTIVVPISQTDRDFPMYYPLTTTQLVKGKVLLDQSIAL
DLTARNVTADEVVETLSKEELEKIINRYKLLFTID
MVSKVSQGDIFYVNFNPSRGHEQKNHRPALAISHDMVRDNSDMTIVVPISQTDRDFPMYYPLTTTQLVKGKVLLDQSIAL
DLTARNVTADEVVETLSKEELEKIINRYKLLFTID
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|