Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4941715..4942231 | Replicon | chromosome |
| Accession | NZ_CP128466 | ||
| Organism | Klebsiella variicola strain 22KM2707 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QSV42_RS24460 | Protein ID | WP_022065401.1 |
| Coordinates | 4941715..4941999 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QSV42_RS24465 | Protein ID | WP_002886901.1 |
| Coordinates | 4941989..4942231 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV42_RS24445 (QSV42_24440) | 4936818..4938473 | + | 1656 | WP_038422038.1 | alpha,alpha-phosphotrehalase | - |
| QSV42_RS24450 (QSV42_24445) | 4938859..4940997 | + | 2139 | WP_044614392.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QSV42_RS24455 (QSV42_24450) | 4941247..4941711 | + | 465 | WP_012969085.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QSV42_RS24460 (QSV42_24455) | 4941715..4941999 | - | 285 | WP_022065401.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QSV42_RS24465 (QSV42_24460) | 4941989..4942231 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QSV42_RS24470 (QSV42_24465) | 4942309..4944219 | - | 1911 | WP_032756354.1 | PRD domain-containing protein | - |
| QSV42_RS24475 (QSV42_24470) | 4944242..4945396 | - | 1155 | WP_070612160.1 | lactonase family protein | - |
| QSV42_RS24480 (QSV42_24475) | 4945491..4946231 | - | 741 | WP_008807137.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11128.97 Da Isoelectric Point: 10.2849
>T284622 WP_022065401.1 NZ_CP128466:c4941999-4941715 [Klebsiella variicola]
MTYELEFDPRAWREWQMPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQMPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|