Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4829314..4829890 | Replicon | chromosome |
| Accession | NZ_CP128466 | ||
| Organism | Klebsiella variicola strain 22KM2707 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | QSV42_RS23965 | Protein ID | WP_012542979.1 |
| Coordinates | 4829603..4829890 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | QSV42_RS23960 | Protein ID | WP_022065028.1 |
| Coordinates | 4829314..4829616 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV42_RS23935 (QSV42_23930) | 4824723..4825787 | - | 1065 | WP_008807596.1 | DUF2955 domain-containing protein | - |
| QSV42_RS23940 (QSV42_23935) | 4825777..4826844 | - | 1068 | WP_064171341.1 | HlyD family secretion protein | - |
| QSV42_RS23945 (QSV42_23940) | 4826851..4827315 | - | 465 | WP_008807598.1 | MarR family transcriptional regulator | - |
| QSV42_RS23950 (QSV42_23945) | 4827481..4827645 | - | 165 | WP_008807599.1 | DUF1127 domain-containing protein | - |
| QSV42_RS23955 (QSV42_23950) | 4827823..4829235 | + | 1413 | WP_008807600.1 | PLP-dependent aminotransferase family protein | - |
| QSV42_RS23960 (QSV42_23955) | 4829314..4829616 | - | 303 | WP_022065028.1 | BrnA antitoxin family protein | Antitoxin |
| QSV42_RS23965 (QSV42_23960) | 4829603..4829890 | - | 288 | WP_012542979.1 | BrnT family toxin | Toxin |
| QSV42_RS23970 (QSV42_23965) | 4830058..4830477 | - | 420 | WP_032740393.1 | FosA5 family fosfomycin resistance glutathione transferase | - |
| QSV42_RS23975 (QSV42_23970) | 4830471..4831379 | - | 909 | WP_012542980.1 | LysR family transcriptional regulator | - |
| QSV42_RS23980 (QSV42_23975) | 4831466..4832248 | + | 783 | WP_012542981.1 | NAD(P)H-dependent oxidoreductase | - |
| QSV42_RS23985 (QSV42_23980) | 4832390..4832974 | + | 585 | WP_004182816.1 | TetR/AcrR family transcriptional regulator | - |
| QSV42_RS23990 (QSV42_23985) | 4832996..4833799 | + | 804 | WP_012969028.1 | winged helix-turn-helix domain-containing protein | - |
| QSV42_RS23995 (QSV42_23990) | 4833796..4834314 | + | 519 | WP_023322003.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11245.77 Da Isoelectric Point: 8.6574
>T284621 WP_012542979.1 NZ_CP128466:c4829890-4829603 [Klebsiella variicola]
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|