Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4223517..4224136 Replicon chromosome
Accession NZ_CP128466
Organism Klebsiella variicola strain 22KM2707

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QSV42_RS21045 Protein ID WP_002892050.1
Coordinates 4223918..4224136 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag QSV42_RS21040 Protein ID WP_008805436.1
Coordinates 4223517..4223891 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSV42_RS21030 (QSV42_21025) 4218672..4219865 + 1194 WP_008805438.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QSV42_RS21035 (QSV42_21030) 4219888..4223034 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
QSV42_RS21040 (QSV42_21035) 4223517..4223891 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
QSV42_RS21045 (QSV42_21040) 4223918..4224136 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QSV42_RS21050 (QSV42_21045) 4224295..4224861 + 567 WP_008805435.1 maltose O-acetyltransferase -
QSV42_RS21055 (QSV42_21050) 4224833..4224961 - 129 Protein_4051 hypothetical protein -
QSV42_RS21060 (QSV42_21055) 4224998..4225468 + 471 WP_008805434.1 YlaC family protein -
QSV42_RS21065 (QSV42_21060) 4225437..4226894 - 1458 WP_289642090.1 PLP-dependent aminotransferase family protein -
QSV42_RS21070 (QSV42_21065) 4226995..4227693 + 699 WP_016160391.1 GNAT family protein -
QSV42_RS21075 (QSV42_21070) 4227690..4227830 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QSV42_RS21080 (QSV42_21075) 4227830..4228093 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T284620 WP_002892050.1 NZ_CP128466:4223918-4224136 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT284620 WP_008805436.1 NZ_CP128466:4223517-4223891 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References