Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1797266..1797856 | Replicon | chromosome |
| Accession | NZ_CP128466 | ||
| Organism | Klebsiella variicola strain 22KM2707 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
| Locus tag | QSV42_RS09045 | Protein ID | WP_008804165.1 |
| Coordinates | 1797524..1797856 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | QSV42_RS09040 | Protein ID | WP_012541132.1 |
| Coordinates | 1797266..1797523 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV42_RS09020 (QSV42_09020) | 1792873..1793448 | + | 576 | WP_012541129.1 | hypothetical protein | - |
| QSV42_RS09025 (QSV42_09025) | 1793627..1794463 | + | 837 | WP_289642568.1 | alpha/beta hydrolase | - |
| QSV42_RS09030 (QSV42_09030) | 1794669..1795640 | + | 972 | WP_012541130.1 | sensor domain-containing diguanylate cyclase | - |
| QSV42_RS09035 (QSV42_09035) | 1795637..1796737 | - | 1101 | WP_048268588.1 | AarF/UbiB family protein | - |
| QSV42_RS09040 (QSV42_09040) | 1797266..1797523 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| QSV42_RS09045 (QSV42_09045) | 1797524..1797856 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QSV42_RS09055 (QSV42_09055) | 1798179..1799615 | + | 1437 | WP_016161429.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| QSV42_RS09065 (QSV42_09065) | 1799988..1801442 | - | 1455 | WP_008804170.1 | AMP nucleosidase | - |
| QSV42_RS09070 (QSV42_09070) | 1801571..1801816 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T284613 WP_008804165.1 NZ_CP128466:1797524-1797856 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LYA2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZQ3 |