Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 783814..784471 | Replicon | chromosome |
Accession | NZ_CP128466 | ||
Organism | Klebsiella variicola strain 22KM2707 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | QSV42_RS04300 | Protein ID | WP_002916310.1 |
Coordinates | 784061..784471 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QSV42_RS04295 | Protein ID | WP_002916312.1 |
Coordinates | 783814..784080 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV42_RS04270 (QSV42_04270) | 778963..780396 | - | 1434 | WP_012967244.1 | 6-phospho-beta-glucosidase BglA | - |
QSV42_RS04275 (QSV42_04275) | 780516..781244 | - | 729 | WP_012967245.1 | MurR/RpiR family transcriptional regulator | - |
QSV42_RS04280 (QSV42_04280) | 781295..781606 | + | 312 | WP_008806430.1 | N(4)-acetylcytidine aminohydrolase | - |
QSV42_RS04285 (QSV42_04285) | 781770..782429 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
QSV42_RS04290 (QSV42_04290) | 782585..783568 | - | 984 | WP_072124459.1 | tRNA-modifying protein YgfZ | - |
QSV42_RS04295 (QSV42_04295) | 783814..784080 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QSV42_RS04300 (QSV42_04300) | 784061..784471 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
QSV42_RS04305 (QSV42_04305) | 784478..784999 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
QSV42_RS04310 (QSV42_04310) | 785100..785996 | + | 897 | WP_008806426.1 | site-specific tyrosine recombinase XerD | - |
QSV42_RS04315 (QSV42_04315) | 786019..786732 | + | 714 | WP_012540593.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QSV42_RS04320 (QSV42_04320) | 786738..788471 | + | 1734 | WP_117106322.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T284611 WP_002916310.1 NZ_CP128466:784061-784471 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |