Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
| Location | 2382747..2383445 | Replicon | chromosome |
| Accession | NZ_CP128464 | ||
| Organism | Enterococcus faecalis strain RE25 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | QSV41_RS12245 | Protein ID | WP_202274464.1 |
| Coordinates | 2383101..2383445 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | QSV41_RS12240 | Protein ID | WP_023895324.1 |
| Coordinates | 2382747..2383082 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV41_RS12200 (2378400) | 2378400..2379176 | - | 777 | WP_010816191.1 | DnaD domain protein | - |
| QSV41_RS12205 (2379192) | 2379192..2380007 | - | 816 | WP_010816192.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| QSV41_RS12210 (2379970) | 2379970..2380935 | - | 966 | WP_010717378.1 | RecT family recombinase | - |
| QSV41_RS12215 (2381036) | 2381036..2381260 | - | 225 | WP_002367281.1 | hypothetical protein | - |
| QSV41_RS12220 (2381369) | 2381369..2381785 | - | 417 | WP_289690717.1 | hypothetical protein | - |
| QSV41_RS12225 (2381786) | 2381786..2381956 | - | 171 | WP_002405829.1 | hypothetical protein | - |
| QSV41_RS12230 (2381991) | 2381991..2382260 | - | 270 | WP_202274460.1 | hypothetical protein | - |
| QSV41_RS12235 (2382273) | 2382273..2382455 | - | 183 | WP_002358110.1 | hypothetical protein | - |
| QSV41_RS12240 (2382747) | 2382747..2383082 | + | 336 | WP_023895324.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QSV41_RS12245 (2383101) | 2383101..2383445 | + | 345 | WP_202274464.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QSV41_RS12250 (2383503) | 2383503..2384231 | + | 729 | WP_002380840.1 | potassium channel family protein | - |
| QSV41_RS12255 (2384386) | 2384386..2385567 | + | 1182 | WP_104844184.1 | site-specific integrase | - |
| QSV41_RS12260 (2385670) | 2385670..2385819 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
| QSV41_RS12265 (2385945) | 2385945..2388080 | - | 2136 | WP_002362471.1 | penicillin-binding protein 2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2348730..2385567 | 36837 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13666.67 Da Isoelectric Point: 5.2241
>T284587 WP_202274464.1 NZ_CP128464:2383101-2383445 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMELYKIPAFRSKMESEAEQ
YMFRILIEKYEGQYNYSNVIAHYNLKMGQEIYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMELYKIPAFRSKMESEAEQ
YMFRILIEKYEGQYNYSNVIAHYNLKMGQEIYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|