Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 411587..412169 | Replicon | chromosome |
Accession | NZ_CP128464 | ||
Organism | Enterococcus faecalis strain RE25 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | QSV41_RS02430 | Protein ID | WP_002355414.1 |
Coordinates | 411861..412169 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | QSV41_RS02425 | Protein ID | WP_002326825.1 |
Coordinates | 411587..411859 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV41_RS02395 (406868) | 406868..407596 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
QSV41_RS02400 (407773) | 407773..408699 | + | 927 | WP_002355406.1 | hypothetical protein | - |
QSV41_RS02405 (408716) | 408716..409999 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
QSV41_RS02410 (410191) | 410191..410313 | + | 123 | Protein_381 | topoisomerase | - |
QSV41_RS02415 (410388) | 410388..411284 | + | 897 | WP_002363034.1 | ParA family protein | - |
QSV41_RS02420 (411361) | 411361..411570 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
QSV41_RS02425 (411587) | 411587..411859 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
QSV41_RS02430 (411861) | 411861..412169 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
QSV41_RS02435 (412249) | 412249..412656 | - | 408 | WP_224571294.1 | tyrosine-type recombinase/integrase | - |
QSV41_RS02440 (412723) | 412723..413223 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
QSV41_RS02445 (413228) | 413228..413995 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QSV41_RS02450 (414482) | 414482..414907 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
QSV41_RS02455 (414924) | 414924..415439 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
QSV41_RS02460 (415450) | 415450..416382 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T284584 WP_002355414.1 NZ_CP128464:411861-412169 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |