Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 12355..13492 | Replicon | plasmid pRE25 |
Accession | NZ_CP128463 | ||
Organism | Enterococcus faecalis strain RE25 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | P0A4M2 |
Locus tag | QSV41_RS00130 | Protein ID | WP_002332783.1 |
Coordinates | 12355..13218 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | QSV41_RS00135 | Protein ID | WP_002326825.1 |
Coordinates | 13220..13492 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV41_RS00100 (QSV41_00100) | 7370..9364 | - | 1995 | WP_229205849.1 | MobA/MobL family protein | - |
QSV41_RS00105 (QSV41_00105) | 9647..9946 | + | 300 | WP_002332653.1 | hypothetical protein | - |
QSV41_RS00110 (QSV41_00110) | 9949..10206 | + | 258 | WP_000002668.1 | hypothetical protein | - |
QSV41_RS00115 (QSV41_00115) | 10300..10533 | - | 234 | WP_002332654.1 | hypothetical protein | - |
QSV41_RS00120 (QSV41_00120) | 10567..11064 | - | 498 | WP_002338758.1 | hypothetical protein | - |
QSV41_RS00125 (QSV41_00125) | 11598..11915 | - | 318 | WP_002326830.1 | hypothetical protein | - |
QSV41_RS00130 (QSV41_00130) | 12355..13218 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
QSV41_RS00135 (QSV41_00135) | 13220..13492 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
QSV41_RS00140 (QSV41_00140) | 13510..13725 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
QSV41_RS00145 (QSV41_00145) | 13817..14713 | - | 897 | WP_002326827.1 | ParA family protein | - |
QSV41_RS00150 (QSV41_00150) | 14816..15076 | - | 261 | Protein_19 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
QSV41_RS00155 (QSV41_00155) | 15246..15983 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
QSV41_RS00160 (QSV41_00160) | 16108..16191 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
QSV41_RS00165 (QSV41_00165) | 16240..16479 | - | 240 | WP_000635249.1 | peptide-binding protein | - |
QSV41_RS00170 (QSV41_00170) | 16613..17830 | - | 1218 | Protein_23 | DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) / cat(pC221) / aph(3')-III / ant(6)-Ia | - | 1..50228 | 50228 | |
- | inside | IScluster/Tn | erm(B) / cat(pC221) / aph(3')-III / ant(6)-Ia | - | 15246..44068 | 28822 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T284581 WP_002332783.1 NZ_CP128463:c13218-12355 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P0A4M2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |