Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
Location | 980457..981273 | Replicon | chromosome |
Accession | NZ_CP128458 | ||
Organism | Geobacillus stearothermophilus strain EF60133 |
Toxin (Protein)
Gene name | hepT | Uniprot ID | G8MYR9 |
Locus tag | QT237_RS05110 | Protein ID | WP_014195290.1 |
Coordinates | 980457..980876 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | mntA | Uniprot ID | - |
Locus tag | QT237_RS05115 | Protein ID | WP_289667385.1 |
Coordinates | 980866..981273 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QT237_RS05090 (QT237_05090) | 976098..977309 | - | 1212 | WP_289667382.1 | amino acid permease | - |
QT237_RS05095 (QT237_05095) | 977881..979575 | + | 1695 | WP_289667383.1 | M3 family oligoendopeptidase | - |
QT237_RS05100 (QT237_05100) | 979796..980314 | + | 519 | WP_289667384.1 | GNAT family N-acetyltransferase | - |
QT237_RS05105 (QT237_05105) | 980334..980429 | + | 96 | Protein_943 | TetR/AcrR family transcriptional regulator | - |
QT237_RS05110 (QT237_05110) | 980457..980876 | - | 420 | WP_014195290.1 | DUF86 domain-containing protein | Toxin |
QT237_RS05115 (QT237_05115) | 980866..981273 | - | 408 | WP_289667385.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
QT237_RS05120 (QT237_05120) | 981554..983686 | - | 2133 | WP_289667386.1 | AAA family ATPase | - |
QT237_RS05125 (QT237_05125) | 983954..984700 | + | 747 | WP_081132891.1 | FixH family protein | - |
QT237_RS05130 (QT237_05130) | 984809..985849 | + | 1041 | WP_023634222.1 | membrane protein | - |
QT237_RS05135 (QT237_05135) | 985934..986095 | - | 162 | WP_160149182.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15907.43 Da Isoelectric Point: 8.2859
>T284578 WP_014195290.1 NZ_CP128458:c980876-980457 [Geobacillus stearothermophilus]
MKSDVILNKISVIERCLKRIREEYNGDPKNLQNYTKQDSIVLNLQRACEACIDLAMHIVAEQKFGLPQHSRDAFALLEEH
GVISPSISKKMKAMVGFRNIAVHDYQQLNLGILQAIVEHHLDDFKQFTKAILDYAKKNS
MKSDVILNKISVIERCLKRIREEYNGDPKNLQNYTKQDSIVLNLQRACEACIDLAMHIVAEQKFGLPQHSRDAFALLEEH
GVISPSISKKMKAMVGFRNIAVHDYQQLNLGILQAIVEHHLDDFKQFTKAILDYAKKNS
Download Length: 420 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15230.44 Da Isoelectric Point: 4.6940
>AT284578 WP_289667385.1 NZ_CP128458:c981273-980866 [Geobacillus stearothermophilus]
MPNEMETIIIQTLRPALHPFVIYLFGSAARGTLRPDSDVDIAFVSDGEPHDPYELFRLAGELADKLGLDVDLVDLRQAST
VFQAQVVSTGKAIDCRDERKRAEFEMKTLKMYVKLNEERAPVLKQITESGSIYEK
MPNEMETIIIQTLRPALHPFVIYLFGSAARGTLRPDSDVDIAFVSDGEPHDPYELFRLAGELADKLGLDVDLVDLRQAST
VFQAQVVSTGKAIDCRDERKRAEFEMKTLKMYVKLNEERAPVLKQITESGSIYEK
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|