Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 233966..234602 | Replicon | chromosome |
| Accession | NZ_CP128458 | ||
| Organism | Geobacillus stearothermophilus strain EF60133 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | L7ZVP1 |
| Locus tag | QT237_RS01245 | Protein ID | WP_003253417.1 |
| Coordinates | 234252..234602 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A087LE06 |
| Locus tag | QT237_RS01240 | Protein ID | WP_033010302.1 |
| Coordinates | 233966..234247 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QT237_RS01220 (QT237_01220) | 230218..230835 | - | 618 | WP_033010298.1 | rhomboid family intramembrane serine protease | - |
| QT237_RS01225 (QT237_01225) | 230954..231343 | + | 390 | WP_033010299.1 | holo-ACP synthase | - |
| QT237_RS01230 (QT237_01230) | 231423..232442 | + | 1020 | WP_277391990.1 | outer membrane lipoprotein carrier protein LolA | - |
| QT237_RS01235 (QT237_01235) | 232685..233851 | + | 1167 | WP_033010307.1 | alanine racemase | - |
| QT237_RS01240 (QT237_01240) | 233966..234247 | + | 282 | WP_033010302.1 | hypothetical protein | Antitoxin |
| QT237_RS01245 (QT237_01245) | 234252..234602 | + | 351 | WP_003253417.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QT237_RS01250 (QT237_01250) | 235145..237307 | + | 2163 | WP_061580987.1 | Tex family protein | - |
| QT237_RS01255 (QT237_01255) | 237365..237478 | - | 114 | WP_094239478.1 | cortex morphogenetic protein CmpA | - |
| QT237_RS01260 (QT237_01260) | 237572..238033 | + | 462 | WP_289667211.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12992.00 Da Isoelectric Point: 4.8781
>T284576 WP_003253417.1 NZ_CP128458:234252-234602 [Geobacillus stearothermophilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9ERQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A087LE06 |