Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 231918..232554 | Replicon | chromosome |
Accession | NZ_CP128454 | ||
Organism | Geobacillus stearothermophilus strain EF60063 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | L7ZVP1 |
Locus tag | QT236_RS01260 | Protein ID | WP_003253417.1 |
Coordinates | 232204..232554 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A087LE06 |
Locus tag | QT236_RS01255 | Protein ID | WP_033010302.1 |
Coordinates | 231918..232199 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QT236_RS01235 (QT236_01235) | 228170..228787 | - | 618 | WP_033010298.1 | rhomboid family intramembrane serine protease | - |
QT236_RS01240 (QT236_01240) | 228906..229295 | + | 390 | WP_033010299.1 | holo-ACP synthase | - |
QT236_RS01245 (QT236_01245) | 229375..230394 | + | 1020 | WP_277391990.1 | outer membrane lipoprotein carrier protein LolA | - |
QT236_RS01250 (QT236_01250) | 230637..231803 | + | 1167 | WP_033010307.1 | alanine racemase | - |
QT236_RS01255 (QT236_01255) | 231918..232199 | + | 282 | WP_033010302.1 | hypothetical protein | Antitoxin |
QT236_RS01260 (QT236_01260) | 232204..232554 | + | 351 | WP_003253417.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QT236_RS01265 (QT236_01265) | 233097..235259 | + | 2163 | WP_061580987.1 | Tex family protein | - |
QT236_RS01270 (QT236_01270) | 235317..235430 | - | 114 | WP_094239478.1 | cortex morphogenetic protein CmpA | - |
QT236_RS01275 (QT236_01275) | 235524..235985 | + | 462 | WP_033016555.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12992.00 Da Isoelectric Point: 4.8781
>T284574 WP_003253417.1 NZ_CP128454:232204-232554 [Geobacillus stearothermophilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9ERQ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087LE06 |