Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 421651..422178 | Replicon | chromosome |
Accession | NZ_CP128435 | ||
Organism | Morganella morganii subsp. morganii strain QLYYMMQL588 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QSV29_RS02045 | Protein ID | WP_024474310.1 |
Coordinates | 421903..422178 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A941UEC5 |
Locus tag | QSV29_RS02040 | Protein ID | WP_000535213.1 |
Coordinates | 421651..421899 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV29_RS02005 | 417181..417813 | + | 633 | WP_024474303.1 | hypothetical protein | - |
QSV29_RS02010 | 417982..418392 | + | 411 | WP_154902787.1 | IrmA family protein | - |
QSV29_RS02015 | 418512..419333 | + | 822 | WP_024474305.1 | DUF932 domain-containing protein | - |
QSV29_RS02020 | 419405..419878 | + | 474 | WP_024474306.1 | DNA repair protein RadC | - |
QSV29_RS02025 | 419923..420249 | + | 327 | WP_024474307.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
QSV29_RS02030 | 420285..420626 | + | 342 | WP_289648771.1 | TA system toxin CbtA family protein | - |
QSV29_RS02035 | 420741..421574 | + | 834 | WP_024474309.1 | DUF4942 domain-containing protein | - |
QSV29_RS02040 | 421651..421899 | + | 249 | WP_000535213.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
QSV29_RS02045 | 421903..422178 | + | 276 | WP_024474310.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QSV29_RS02050 | 422295..423092 | + | 798 | WP_024474311.1 | helix-turn-helix domain-containing protein | - |
QSV29_RS02055 | 423615..424778 | + | 1164 | Protein_379 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 393872..431107 | 37235 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10983.32 Da Isoelectric Point: 4.6998
>T284564 WP_024474310.1 NZ_CP128435:421903-422178 [Morganella morganii subsp. morganii]
MEVYWTLKAQDDLERIYRFALQYSRQHADDVLDRLMTGCAGLTANPAIGIQQTRYEPREVRKVLFDDYEVHYELRDSDIY
IVDLWHTKEER
MEVYWTLKAQDDLERIYRFALQYSRQHADDVLDRLMTGCAGLTANPAIGIQQTRYEPREVRKVLFDDYEVHYELRDSDIY
IVDLWHTKEER
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|