Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 419923..420626 | Replicon | chromosome |
| Accession | NZ_CP128435 | ||
| Organism | Morganella morganii subsp. morganii strain QLYYMMQL588 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | QSV29_RS02030 | Protein ID | WP_289648771.1 |
| Coordinates | 420285..420626 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | QSV29_RS02025 | Protein ID | WP_024474307.1 |
| Coordinates | 419923..420249 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV29_RS01995 | 415386..416261 | + | 876 | WP_024474301.1 | dynamin family protein | - |
| QSV29_RS02000 | 416474..417175 | + | 702 | WP_024474302.1 | WYL domain-containing protein | - |
| QSV29_RS02005 | 417181..417813 | + | 633 | WP_024474303.1 | hypothetical protein | - |
| QSV29_RS02010 | 417982..418392 | + | 411 | WP_154902787.1 | IrmA family protein | - |
| QSV29_RS02015 | 418512..419333 | + | 822 | WP_024474305.1 | DUF932 domain-containing protein | - |
| QSV29_RS02020 | 419405..419878 | + | 474 | WP_024474306.1 | DNA repair protein RadC | - |
| QSV29_RS02025 | 419923..420249 | + | 327 | WP_024474307.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QSV29_RS02030 | 420285..420626 | + | 342 | WP_289648771.1 | TA system toxin CbtA family protein | Toxin |
| QSV29_RS02035 | 420741..421574 | + | 834 | WP_024474309.1 | DUF4942 domain-containing protein | - |
| QSV29_RS02040 | 421651..421899 | + | 249 | WP_000535213.1 | ribbon-helix-helix domain-containing protein | - |
| QSV29_RS02045 | 421903..422178 | + | 276 | WP_024474310.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QSV29_RS02050 | 422295..423092 | + | 798 | WP_024474311.1 | helix-turn-helix domain-containing protein | - |
| QSV29_RS02055 | 423615..424778 | + | 1164 | Protein_379 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 393872..431107 | 37235 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12817.73 Da Isoelectric Point: 10.4209
>T284563 WP_289648771.1 NZ_CP128435:420285-420626 [Morganella morganii subsp. morganii]
MKTLPASTLRAAKPCPTPVVVWQTLLTRLLGQHYGLTLNDTPFSDENVIQEHINAGITLADAVNFLVEKYELVRIDRRGF
SRQEQSPYLRAVDILRARQATGLLRRSHHPSTR
MKTLPASTLRAAKPCPTPVVVWQTLLTRLLGQHYGLTLNDTPFSDENVIQEHINAGITLADAVNFLVEKYELVRIDRRGF
SRQEQSPYLRAVDILRARQATGLLRRSHHPSTR
Download Length: 342 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 12449.12 Da Isoelectric Point: 6.0722
>AT284563 WP_024474307.1 NZ_CP128435:419923-420249 [Morganella morganii subsp. morganii]
MEKNDPIEWGLRRDITPRVGARLVQERNQLHYLADRAGVTGIFNEAESRKLNAAFPHFVEQMELMLLSGELNPRYAHCVT
LYHDGFTCEADTLGSYGYVYIVIYPTQR
MEKNDPIEWGLRRDITPRVGARLVQERNQLHYLADRAGVTGIFNEAESRKLNAAFPHFVEQMELMLLSGELNPRYAHCVT
LYHDGFTCEADTLGSYGYVYIVIYPTQR
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|