Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 4852303..4852856 Replicon chromosome
Accession NZ_CP128416
Organism Rhizobium sp. CSC1952

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QTA58_RS23590 Protein ID WP_289671132.1
Coordinates 4852303..4852632 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QTA58_RS23595 Protein ID WP_289671133.1
Coordinates 4852632..4852856 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTA58_RS23565 (QTA58_23565) 4848318..4848632 + 315 WP_085423168.1 DUF1883 domain-containing protein -
QTA58_RS23570 (QTA58_23570) 4848656..4849972 - 1317 WP_289671129.1 replication-associated recombination protein A -
QTA58_RS23575 (QTA58_23575) 4849969..4851372 - 1404 WP_085423166.1 DegQ family serine endoprotease -
QTA58_RS23580 (QTA58_23580) 4851507..4851887 + 381 WP_289671130.1 YkvA family protein -
QTA58_RS23585 (QTA58_23585) 4851923..4852285 + 363 WP_289671131.1 hypothetical protein -
QTA58_RS23590 (QTA58_23590) 4852303..4852632 - 330 WP_289671132.1 DUF5615 family PIN-like protein Toxin
QTA58_RS23595 (QTA58_23595) 4852632..4852856 - 225 WP_289671133.1 DUF433 domain-containing protein Antitoxin
QTA58_RS23600 (QTA58_23600) 4852946..4854781 - 1836 WP_289671134.1 dihydroxy-acid dehydratase -
QTA58_RS23605 (QTA58_23605) 4854933..4855343 - 411 WP_289671135.1 DUF4112 domain-containing protein -
QTA58_RS23610 (QTA58_23610) 4855551..4856495 + 945 WP_289671136.1 protein-methionine-sulfoxide reductase catalytic subunit MsrP -
QTA58_RS23615 (QTA58_23615) 4856495..4857136 + 642 WP_289671137.1 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ -
QTA58_RS23620 (QTA58_23620) 4857194..4857619 - 426 WP_085423157.1 50S ribosomal protein L17 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 4810971..4864525 53554


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-76)

Antitoxin

Protein of unknown function DUF433

(7-62)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12292.99 Da        Isoelectric Point: 4.6647

>T284562 WP_289671132.1 NZ_CP128416:c4852632-4852303 [Rhizobium sp. CSC1952]
MRFLVDAQLPPALARWLSGQGHQAEHVMDCGLQSASDREIWDFATASVAVIVTKDEDFAQRRALTDAGPSIIWIRLPNSR
RRDLLDWFEKALPDILNALEHGETLVEVI

Download         Length: 330 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8332.60 Da        Isoelectric Point: 4.5514

>AT284562 WP_289671133.1 NZ_CP128416:c4852856-4852632 [Rhizobium sp. CSC1952]
MSELHRITFDPQICSGRPIIRGLRIRVKDILELLASGASQDEILEDYPMLEAEDIVAALEYAARQSDHIVLRVA

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References