Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4566376..4566895 | Replicon | chromosome |
Accession | NZ_CP128416 | ||
Organism | Rhizobium sp. CSC1952 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QTA58_RS22085 | Protein ID | WP_289670847.1 |
Coordinates | 4566376..4566657 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QTA58_RS22090 | Protein ID | WP_289670848.1 |
Coordinates | 4566647..4566895 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTA58_RS22065 (QTA58_22065) | 4561676..4562893 | - | 1218 | WP_085424196.1 | LL-diaminopimelate aminotransferase | - |
QTA58_RS22070 (QTA58_22070) | 4563009..4563380 | - | 372 | WP_143531756.1 | hypothetical protein | - |
QTA58_RS22075 (QTA58_22075) | 4563543..4565390 | + | 1848 | WP_289670845.1 | class I poly(R)-hydroxyalkanoic acid synthase | - |
QTA58_RS22080 (QTA58_22080) | 4565401..4566108 | + | 708 | WP_289670846.1 | DNA/RNA nuclease SfsA | - |
QTA58_RS22085 (QTA58_22085) | 4566376..4566657 | - | 282 | WP_289670847.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QTA58_RS22090 (QTA58_22090) | 4566647..4566895 | - | 249 | WP_289670848.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QTA58_RS22095 (QTA58_22095) | 4567074..4567910 | + | 837 | WP_085424192.1 | type I methionyl aminopeptidase | - |
QTA58_RS22100 (QTA58_22100) | 4567912..4568715 | + | 804 | WP_289670849.1 | DNA repair protein RadC | - |
QTA58_RS22105 (QTA58_22105) | 4568895..4570706 | - | 1812 | WP_289670850.1 | ABC transporter ATP-binding protein | - |
QTA58_RS22110 (QTA58_22110) | 4570722..4571483 | - | 762 | WP_289670852.1 | DUF1028 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10894.73 Da Isoelectric Point: 10.8319
>T284561 WP_289670847.1 NZ_CP128416:c4566657-4566376 [Rhizobium sp. CSC1952]
MSYELAFLDAALKEWRKLDPNIRDQFRKKLAERLENPRVPSAQLYGAKDRYKIKLRTAGYRLVYEVRDAQLIVLVIAVGR
RDRNAVYKAAGKR
MSYELAFLDAALKEWRKLDPNIRDQFRKKLAERLENPRVPSAQLYGAKDRYKIKLRTAGYRLVYEVRDAQLIVLVIAVGR
RDRNAVYKAAGKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|