Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 4434492..4435045 | Replicon | chromosome |
| Accession | NZ_CP128416 | ||
| Organism | Rhizobium sp. CSC1952 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QTA58_RS21415 | Protein ID | WP_289670729.1 |
| Coordinates | 4434752..4435045 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QTA58_RS21410 | Protein ID | WP_289670727.1 |
| Coordinates | 4434492..4434764 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTA58_RS21385 (QTA58_21385) | 4429544..4430470 | - | 927 | WP_289670722.1 | alpha/beta hydrolase | - |
| QTA58_RS21390 (QTA58_21390) | 4430519..4430995 | + | 477 | WP_289670723.1 | MarR family transcriptional regulator | - |
| QTA58_RS21395 (QTA58_21395) | 4431003..4432826 | - | 1824 | WP_289670725.1 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
| QTA58_RS21400 (QTA58_21400) | 4432856..4433215 | - | 360 | WP_085424312.1 | DUF971 domain-containing protein | - |
| QTA58_RS21405 (QTA58_21405) | 4433435..4434424 | + | 990 | WP_289673264.1 | GTP 3',8-cyclase MoaA | - |
| QTA58_RS21410 (QTA58_21410) | 4434492..4434764 | + | 273 | WP_289670727.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QTA58_RS21415 (QTA58_21415) | 4434752..4435045 | + | 294 | WP_289670729.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QTA58_RS21420 (QTA58_21420) | 4435087..4435857 | - | 771 | WP_289670730.1 | SDR family oxidoreductase | - |
| QTA58_RS21425 (QTA58_21425) | 4435948..4436430 | - | 483 | WP_289670732.1 | hypothetical protein | - |
| QTA58_RS21430 (QTA58_21430) | 4436596..4437477 | + | 882 | WP_289670734.1 | LysR family transcriptional regulator | - |
| QTA58_RS21435 (QTA58_21435) | 4437482..4440043 | - | 2562 | WP_289670736.1 | HAMP domain-containing methyl-accepting chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11019.68 Da Isoelectric Point: 9.8561
>T284560 WP_289670729.1 NZ_CP128416:4434752-4435045 [Rhizobium sp. CSC1952]
VPQVIVTRGAILGIERCRTFLKKAGVQVSRRASDAISRQFALLETSPEIGRPFQHNAELRELLIPFGASGYIALYRYEPD
GDAVYVLAFRHQREVRY
VPQVIVTRGAILGIERCRTFLKKAGVQVSRRASDAISRQFALLETSPEIGRPFQHNAELRELLIPFGASGYIALYRYEPD
GDAVYVLAFRHQREVRY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|